Conserved Protein Domain Family
PTZ00207

?
PTZ00207: PTZ00207 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 140234
View PSSM: PTZ00207
Aligned: 9 rows
Threshold Bit Score: 940.41
Threshold Setting Gi: 72392397
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72391844   1 MSAPVDNVVVERLSTANQKPINEPRRFALLVLGTFCCICTSFMYAFNLISGAMQARYNLTQRDLSTITTVGIAVGYFLLP 80 
72391846   1 MSAPVDNVVVERLSTANQKPINEPRRFALLVLGTFCCICTSFMYAFNLISGAMQARYNLTQRDLSTITTVGIAVGYFLLP 80 
72391848   1 MSAPVDNVVVERLSTANQKPINEPRRFALLVLGTCCSICTSFMYAFNLISGTMQARYRFSVKDIMNVNAVGLAVGYFMLP 80 
72391850   1 MSAPVDNVVVERLSTANQKPVSEPRRFLMLVIGVSCSMCTSFMYAFNLISGAMQERYDLTQRDLSTITTVGICVGYFMLP 80 
72391852   1 MSAPVDNVVVERLSTANQKPINEPRRFALLVLGAFCSMCTSFLYAFNLVSGAMQARYNLTQRDLSTITTVGIAVGYFLLP 80 
72391854   1 MSAPVDNVVVERLSTANQKPVSEPRRFLMLVIGVSCSMCTSFMYAFNLISGAMQERYDLTQRDLSTITTVGICVGYFMLP 80 
72391856   1 MSAPVDNVVVERLSTANQKPINEPRRFALLVLGAFCSMCTSFLYAFNLVSGAMQARYNLTQRDLSTITTVGIAVGYFLLP 80 
72391858   1 MSAPVDNVVVERLSTANQKPVSEPRRFATLVLGVFCCMCTSFMYAFNLISGAMQERYDLTQRDLSTITTVGIVVGYFLLP 80 
72392397   1 MNCAADH-VVERLPTARQQPAGEPHRFGLLAVAAFSCICVSLTYGFNLISGAMQERYGLTQRDLSTISTVGIAVGYFGLP 79 
72391844  81 YSFIFDYLGPKPIFVIAMTVFCLGALLFALTFQEVIEGSVVRLSVYNGFLTLGCMLFDLGSVVTVLSVFPSNRGAVMAIV 160
72391846  81 YSFIFDYLGPKPIFVIAMTVFCLGALLFALTFQEVIEGSVVRLSVYNGFLTLGCMLFDLGSVVTVLSVFPSNRGAVMAIV 160
72391848  81 YGFIYDYLGPRPIFMLSLTVLCLGALLFALTLRGDIEGTVVRLSVYNGLMTLGCMLFDLGGVVTVLSVFPSNRGAIVAIM 160
72391850  81 YGFIYDYLGPRPVFVISMTVFCLGTLLLALTFQEVIEGSVVRLSVYNALMMLGCTLFDLGALVTVLSVFPSNRGIVVATM 160
72391852  81 YSFIYDYLGPRPIFMLSVTVFCLGTLLLALTFQEVIEGSVVRLSVYNGLMTLGCMLFDLGGVVTVLSVFPSNRGAIVAIM 160
72391854  81 YGFIYDYLGPRPVFVISMTVFCLGTLLLALTFQEVIEGSVVRLSVYNALMMLGCTLFDLGALVTVLSVFPSNRGIVVATM 160
72391856  81 YSFIYDYLGPRPIFMLSVTVFCLGTLLLALTFQEVIEGSVVRLSVYNGLMTLGCMLFDLGGVVTVLSVFPSNRGAIVAIM 160
72391858  81 YGFIYDYLGPRPVFVISMTVFCLGTLLLALTFQEVIEGSVVRLSVYNGLMVLGCMLFDLGAVVTVLSVFPSNRGAVMAIM 160
72392397  80 YSFIYDHFGPKPIYFLGLLCYLLGTVMFALTFQGVIEGTVLRLSIYNASVTLGCSMFDMGALVTLLSVFPSNRGAVVAML 159
72391844 161 KTFTGLGSAIVGSIQLAFFSKSVANYFFFLMSFSLVVGTLAVVFMNLPPFHLTGYQKTHLDEEEKAQRLARKGVYLKQKA 240
72391846 161 KTFTGLGAAIVGSIQLAFFSKSVANYFFFLMSFSLVVGTLAVVFMNLPPFHLTGYQKTHLDEEEKAQRLARKGVYLKQKA 240
72391848 161 KSFVGLGAAILGSIQLAFFSDRPDIYFFSIMSFALTVGILGIVFMRLPPFHLTGYQEKHLDEEEKAQLRMTKTVYLKQKA 240
72391850 161 KTTTGLGSAILGSIRLAFFSGNTSAYFYFLMSWALAAGILALTFVRLPPFHLTGYQEKHLDEEEKAQLRMTKTVYLKQKA 240
72391852 161 KSFAGLGSAILGSIQLAFFSDRPDIYFFSIMSFALTVGILGIVFMRLPPFHLTGYQEKHLDEEEKAQRLARKGVYLKQKA 240
72391854 161 KTTTGLGSAILGSIRLAFFSGNTSAYFYFLMSWALAAGILALTFVRLPPFHLTGYQEKHLDEEEKAQLRMTKTVYLKQKA 240
72391856 161 KSFAGLGSAILGSIQLAFFSDRPDIYFFSIMSFALTVGILGIVFMRLPPFHLTGYQEKHLDEEEKAQRLARKGVYLKQKA 240
72391858 161 KTFTGLGSAIVGCIRLGFLSQSTSAYFYFLMSFALAAGILAIAFLRLPPFHLTGYQEKHLDEEEKAQLRVTKGVYLKQKA 240
72392397 160 KTLNGLGAAIVGSVRLAFFSENTSAYFYFLMTLVIVIGTLATAYVRLPSYHLTGYEENHLSEEEKVKRLMRKAVYLRQKA 239
72391844 241 PMWRFVHGFAILVTLIVFLPLQGALVAYLKLGSNFKVGFAVTVIVLTVIFPFMAYPLTTFDGKRPHDDSEGETCCRREVA 320
72391846 241 PMWRFIYGFVVLLILVVFLPLEGALVAYLKLGSNFKVGFAVTVIVLTVIFPFMAFPLTTFDGKRPHDDSEGDAKEHVEAD 320
72391848 241 PMWRFIYGFVLLLILVVFLPLQGALVAYLKLGSNFKVGFAVTVIVLTAIFPFMAFPLTTFDGKRPHDDSDGEVDDKEEMS 320
72391850 241 PMWRFVHGFAILVTLIVFLPLQGSLVAYLKLGSNFKVGFALVVIALIVIFPFMAFPLTTFDGKRPHDDSDSKAKEHVGAG 320
72391852 241 PMWRFIYGFVLLIILIFFLPLQGALVAYLKLGSNFKVGFAVTVIVLTAIFPFMAFPLTTFDGKRPHDDSDGEVDDKEEMS 320
72391854 241 PMWRFVHGFAILVTLIVFLPLQGSLVAYLKLGSNFRVGFALVVIALIVIFPFMAFPLTTFDGKRPHDDSDSKAKEHVGAG 320
72391856 241 PMWRFIYGFVLLIILIFFLPLQGALVAYLKLGSNFKVGFAVTVIVLTAIFPFMAFPLTTFDGKRPHDDSDGEVDDKEEMS 320
72391858 241 PMWRFVYGFAILLILIVFLPLQGSLSAYLKLGSNFRVGFALVVIALIVIFPFMAFPLTTFDGKRPHDDSDSKAKEHVGAG 320
72392397 240 PTWRFVHGFVILIALIVFLPTQGALLAYLKLGSDYKVGFAVVTIILTLLLPLMAIPTTKFDGNNQRIGIDDKSPTEGAVG 319
72391844 321 -EEVSASDDTGVETDVDYIAPQFQETFIEGLKTARLWCLLWSIFCCVGVHYVIIYNARFIYTALAGEAPDDALNALLTVL 399
72391846 321 -DEVSAAEDKVVETDVDYIAPQFQETFIEGLKTARLWCLLWSIFCCVGVHYVIIYNARFIYTALAGEAPDDALNALLTVL 399
72391848 321 -EEPFPVEDKVVETDVDYIAPQFQETFIEGLKTARLWCLLSSVFCCVGGSFVVVFNSRFLYTALAGEPPSTNVGILLSVL 399
72391850 321 -DEISAAEDKVVETDVDYIAPQFQETFIAGLKTARLWCLLWSAFCCLGANYVIIYNARFFYTALAGEAPEDALNTLLTVL 399
72391852 321 -EEPFPVEDKVVETDVDYIAPQFQETFFESLKTARLWCLLWSIFCCVGAEFVIIFNARFVYTALAGEVPDDALNTLLTVL 399
72391854 321 -DEVSAAEDKVVETDVDYIAPQFQETFIAGLKTARLWCLLWSAFCCLGANYVIIYNARFFYTALAGEAPEDALNTLLTVL 399
72391856 321 -EEPFPVEDKVVETDVDYIAPQFQETFFESLKTARLWCLLWSIFCCVGAEFVIIFNARFVYTALAGEVPDDALNTLLTVL 399
72391858 321 -DEVSAAEDKVVETDVDYIAPQFQETFIAGLKTARLWCLLWSVFCCVGVHYVVIYNARFIYTALTGEAPEDALNTLLTVL 399
72392397 320 sNDGDSSGSNVVETNVDYIAPQFQESFLAGLRTLRLWCLMFTIFFCAGSLFVVMFNARYIYTAMVGEAPDEALNTLLTVL 399
72391844 400 NGVGSAVGRLCMSYFEVWSQKRRAEDRVPITFSMFVPSVCIITMLTLFLTLPKAALPLPYFIAALSNGFTAAIIALVTRT 479
72391846 400 NGVGSAVGRLCMGYFEVWSQKRRAEDRVPITLSMFVPSVCIITMLTLFLTLPKAALPLPYFIAAFSNGFMAATMALVTRT 479
72391848 400 GALGSAVGRLLTSGVEIWSQKRRAEDRVPITIALFIPSVCIITMLTLFLTLPKAALPLPHFLAAVADGFMATTTPLVART 479
72391850 400 NGAGSAVGRLCMGYFEIWSQKRPAADRIPITAALYVPSVCIITMLTLFLTLPKAALPLPYFIVAFSNGFTAATMALVTRT 479
72391852 400 NGVGSAVGRLCMSYFEIWSQKRRAEDRVPITIALFIPSVCIITMLTLFLTLPKAALPLPYFIAATANGFMATTIALVART 479
72391854 400 NGAGSAVGRLCMGYFEIWSQKRPAADRIPITAALYVPSVCIITMLTLFLTLPKAALPLPYFIVAFSNGFTAATMALVTRT 479
72391856 400 NGVGSAVGRLCMSYFEIWSQKRRAEDRVPITIALFIPSVCIITMLTLFLTLPKAALPLPYFIAATANGFMATTIALVART 479
72391858 400 NGVGSAVGRLCMSYFEIWSQKRRAEDRVPITIALFIPSVCIITMLTLFLTLPKAALPLPYFIAAFSNGFTAAIIALVTRT 479
72392397 400 GGAGSATGRLGMSFFEVWSQKRKPEQRVPITVVLFIPTTFVIIMLTMFLTVPKSVLPLSYFIGALANGCNSATIILVSRT 479
72391844 480 IFAKDPAKHYNFCFLGSVLSAIFLNRLLYGEWYTQQADKLGQDVCTERVCVVMPLAFMLGLAFPAFATSTYLHLQYRRLC 559
72391846 480 IFAKDPAKHYNFCFLGSVLSAIFLNRLLYGEWYTQQADKLDQDVCTERVCVVMPLAFMLGLAFPAFATSTYLHLQYRNLC 559
72391848 480 IFAKDPAKHYNFCFLGSVLSAIFLNRLLYGEWYTQQADKLGQDVCTERVCVVMPLAFLLGLSFLAFITSTYVHLQYRNLC 559
72391850 480 IFAKDPAKHYNFCFIGSIMSAIFLNRLLYGEWYTQQADKLGQDVCTERVCVVMPLAFMLGLAFLGFLTTTYLHLQYRRLC 559
72391852 480 IFAKDPAKHYDFCFLGSMLSAIFLNRLLYGEWYTQQADKLGQDVCTERVCVVMPLAFLLGLSFLAFITSTYVHLQYRNLC 559
72391854 480 IFAKDPAKHYNFCFIGSIMSAIFLNRLLYGEWYTQQADKLGQDVCKKRVCVVMPLAFMLGLAFLGFLTTTYLHLQYRRLC 559
72391856 480 IFAKDPAKHYDFCFLGSMLSAIFLNRLLYGEWYTQQADKLGQDVCTERVCVVMPLAFLLGLSFLAFITSTYVHLQYRNLC 559
72391858 480 IFAKDPAKHYNFCYLASVLSAIFLNRLLYGEWYTQQADKLGQDVCKKRVCVVMPLAFMLGLAFPAFATSTYLHLQYRRLC 559
72392397 480 IFAKDPAKHYYFCYIGSLLSAIFLNRLLYGEWYTHEAEKRGEVVCTDKVCVMMPMMLLLVLSLLAFVSSSYVHVQYRRLC 559
72391844 560 MLALDERRRIREGERGPKEPSSCPKEPTRDAR 591
72391846 560 LKALEERRRIKEAEDNQTNAENVCAEPTCDDN 591
72391848 560 LKALEERQRVKEQHRASKDDSRVSTEPIGVI- 590
72391850 560 KLALEERQRIREEERVLNELPSNPTEPTGNAG 591
72391852 560 LKALEERRRIREGEEALNDESLSHTE------ 585
72391854 560 KLALEERQRIREEERVLNELPSNPTEPTGNAG 591
72391856 560 LKALEERRRIREGEEALNDESLSHTE------ 585
72391858 560 TLALEERQRIREEERVLNELPSNPIEPTGNAG 591
72392397 560 TKALEERRRIREEEAAARRQLSGATATAELPN 591
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap