Conserved Protein Domain Family
PTZ00198

?
PTZ00198: PTZ00198 
60S ribosomal protein L22; Provisional
Statistics
?
PSSM-Id: 173474
View PSSM: PTZ00198
Aligned: 27 rows
Threshold Bit Score: 138.257
Threshold Setting Gi: 229595912
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71748294    6 AKVGSRGFTRQRQLAKGKKVFKIDCSIPASDGIFSddiLSNFQQYFQDNVKLNGRKGKLTSKVRVNMRENILSITTTMAY 85 
66804255    1 ------MPNVQKTVVKKSHKFVIDCTAPA-GKIVD---VAAFEKYLHDRIKVDNKVSNLGSNVVISKDKSKIIINTTIPF 70 
66806369    1 ------MPSVQKTVVKKSHKFVIDCTAPA-GKIVD---VAAFEKYLHDRIKVDNKVGNLGSTVVISKDKSKIIINTTIPF 70 
156097825  19 KKSKVAVKKPKTMKSTKGVKYILDCTKPVKDTILD---ISGLEQFFKDKIKVDKKTNNLKNKIVVTSDDCKIYITVHIPF 95 
156084454   1 MKGVKKASNAKTIQPGQKSKFLLDCTAPANDNIIN---PSGLEKFLQDRIKVDGKTGNLGTNITVTREKNKIYVVADIPF 77 
124512350  22 TKIVKGLKKQKMNKSTKGIKYVLDCTKPVKDTILD---ISGLEQFFKDKIKVDKKTNNLKNKVVVTSDEYKIYITVHIPF 98 
145540908   1 --MPILRRKDQQKAKNLNLKFIIDCAEPKEDKVLN---LDEFVSYLQSRIKVQGKTGNLGNDVTVSAEQEKVVVTSTIPF 75 
145537600   1 --MPILRRKDQQKAKNLNLKFVIDCTEPKEDKVLN---LDEFVSYLQSRIKVQGKTGNLGNDVTVAAEQDKVVVTSTIPF 75 
237834635  10 GSGRGAGGKKGAAAKPVKVKFTVDCQKPVDDNIIE---AKGLERFLQTHIKVDGKCNNLGDRVQVSREKAKVFVTAELPF 86 
221053464  19 KKSQIAVKKPKAMKSTKGIKYILDCTKPVKDTILD---ISGLEQFFKDKIKVDKKTNNLKNKIVVTSDDCKIYITVHIPF 95 
71748294   86 RKKYFKYLTKKFLKKKDLRDWIRILAKGKDTYQLKYFNIQDQEEA 130
66804255   71 SKRYLKYLTKKFLKFKQIRDFLRVVATTKNTYELRYFNIGDSESQ 115
66806369   71 SKRYLKYLTKKFLKFKQIRDFLRVVATTKNTYELRYFNIGDSESQ 115
156097825  96 SKRYIKYLAKKYLKMHQIRDFLRVIAKGKLAYEFKYFQLNN---- 136
156084454  78 SKRYIKYLTKKYLKKQQLRDFLRVVANKEHSYELRYFQINDEAES 122
124512350  99 SKRYIKYLAKKYIKMHQIRDFLRVIAKGKLAYEFKYFQLNN---- 139
145540908  76 SKRYLRYLTKKYLKQETLREYLYVHSLDKSTYQLKYFNVGQDEEE 120
145537600  76 SKRYLKYLTKKYLKQETLREYLYVHSLDKATYQLKYFNVGQDEEE 120
237834635  87 SKRYIKYLTKKYLKKQMLRDFMRVVSSRDTVYELRYFQMPQEDET 131
221053464  96 SKRYIKYLAKKYLKMHQIRDFLRVIAKGKLAYEFKYFQLNN---- 136
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap