Conserved Protein Domain Family
PTZ00195

?
PTZ00195: PTZ00195 
60S ribosomal protein L18; Provisional
Statistics
?
PSSM-Id: 140222
View PSSM: PTZ00195
Aligned: 11 rows
Threshold Bit Score: 348.945
Threshold Setting Gi: 146080757
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154333852   1 MGVDLTGISKKSRVVRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAK 80 
71404909  131 MGVDLTGVQKKKRVVRHHTYSTNPYIKLLIKLYKFLAQRTNSGFNKLVHQRLLKSRSNRAPISLSRIAVCMKRKSVWLEK 210
71650291  106 MGVDLTGVQKKKRVVRHHTYSTNPYIKLLIKLYKFLAQRTNSAFNKLVHQRLLKSRSNRAPISLSRIAVCMKRKSVWLEK 185
71665719    1 MGVDLTGVQKKKRVVRHHTYSTNPYIKLLIKLYKFLAQRTNSAFNKLVHQRLLKSRSNRAPISLSRIAVCMKRKSVWLEK 80 
71755183    1 MGVDLTGVQKKKRVVRHHTYSTNPYIKLLIKLYKFLGKRTNSPFNKLIHKRLLKSRNNRAPISLSRIAVCMRRRTVWLKK 80 
71748310    1 MGVDLTGVQKKKRVVRHHTYSTNPYIKLLIKLYKFLGKRTNSPFNKLIHKRLLKSRNNRAPISLSRIAVCMRRRTVWLKK 80 
146080757   1 MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAK 80 
146104518   1 MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAK 80 
157877436   1 MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAK 80 
154346312   1 MGVDLTGISKKSRVVRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPLSLSRIAVVMKRKAVFTAK 80 
157866188   1 MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAK 80 
154333852  81 CKKAPIAVVVGDVLDDVRMARIPAMRVCALRFSKNARQSIVAAGGECLTFDQLAMIAPTGKNTYLMRGRKSGRESVRHFG 160
71404909  211 GKKAPIAVIVGDVLDDVRMTRIPALRVCALRFSKSARERITGAGGECLTFDQLAMVAPTGKNTFLLRGRKSGRESVKHFG 290
71650291  186 GKKAPIAVIVGDVLDDVRMTRIPALRVCALRFSKSARERITGAGGECLTFDQLAMVAPTGKNTFLLRGRKSGRESVKHFG 265
71665719   81 GKKAPIAVIVGDVLDDVRMARIPALRVCALRFSKSARERITGAGGECLTFDQLAMVAPTGKNTFLLRGRKSGRESVKHFG 160
71755183   81 GKKSPIAVIVGDVLDDVRMTRIPALRICALRFSKSARERITGAGGECLTFDQLAMMAPTGKNTMLLRGRKSGRESVKHFG 160
71748310   81 GKKSPIAVIVGDVLDDVRMTRIPALRICALRFSKSARERITGAGGECLTFDQLAMMAPTGKNTMLLRGRKSGRESVKHFG 160
146080757  81 SKAAPIAVVVGDVLDDVRMARIPAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFG 160
146104518  81 SKAAPIAVVVGDVLDDVRMARIPAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFG 160
157877436  81 SKAAPIAVVVGDVLDDVRMARIPAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFG 160
154346312  81 CKKAPIAVVVGDVLDDVRMARIPAMRVCALRFSKNARQSIVAAGGECLTFDQLAMIAPTGKNTYLMRGRKSGRESVRHFG 160
157866188  81 SKAAPIAVVVGDVLDDVRMARIPAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFG 160
154333852 161 ASGVPGSHSKPYATNRGKETKRGRRpgqsyKRKAFRHV 198
71404909  291 AAGVPGSHAKPFTSNRGKERQRSSA-----RRRAFRHK 323
71650291  266 AAGVPGSHAKPFTSNRGKERQRSSA-----RRRAFRHK 298
71665719  161 AAGVPGSHAKPFTSNRGKERQRSSA-----RRRAFRHK 193
71755183  161 AAGVPGSHAKPHVSSRGKERQRSSK-----RRHAFRHK 193
71748310  161 AAGVPGSHAKPHVSSRGKERQRSSK-----RRHAFRHK 193
146080757 161 ASGVPGSHSKPYATNRGKETKRGRRtgrsyKRKAFRHV 198
146104518 161 ASGVPGSHSKPYATNRGKETKRGRRtgrsyKRKAFRHV 198
157877436 161 ASGVPGSHSKPYATNRGKETKRGRRtgrsyKRKAFRHV 198
154346312 161 ASGVPGSHSKPYATNRGKETKRGRRpgqsyKRKAFRHV 198
157866188 161 ASGVPGSHSKPYATNRGKETKRGRRtgrsyKRKAFRHV 198
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap