Conserved Protein Domain Family
PTZ00193

?
PTZ00193: PTZ00193 
60S ribosomal protein L31; Provisional
Statistics
?
PSSM-Id: 140220
View PSSM: PTZ00193
Aligned: 11 rows
Threshold Bit Score: 290.01
Threshold Setting Gi: 146101529
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71413116    1 MTRAGFKGKLLGKERKQALLDARKKAVASRKARDDRRWKRVLAKMDSEKRKKYHGVGNTAEHSRVRGITRAALRKRTGRK 80 
71411582    1 MTRAGFKGKVLGKERKQALLDARKKAVASRKARDDRRWKRVLAKMDSEKRKKYHGVGNTAEHSRVRGITRAALRKRTGRK 80 
71411570    1 MTRAGFKGKVLGKERKQALLDARKKAVASRKARDDRRWKRVLAKMDSEKRKKYHGVGNTAEHSRVRGITRAALRKRTGRK 80 
71413124    1 MTRAGFKGKLLGKERKQALLDARKKAVASRKARDDRRWKRVLAKMDSEKRKKYHGVGNTAEHSRVRGITRAALRKRTGRK 80 
71745682    1 MTRAGFKGKVLGKEKKLALLEARKKAAEARKSRDDRRWKRVLAKMDPEKRKKYHGVGNTAEHSRVRGCTRASLFKRTGRK 80 
71745684    1 MTRAGFKGKVLGKEKKLALLEARKKAAEARKSRDDRRWKRVLAKMDPEKRKKYHGVGNTAEHSRVRGCTRASLFKRTGRK 80 
72548801    1 MTRAGMKGKVLGKEKKAAIIDARKKAAESRKNRDDKRWKRVLANMDEEKRKKFHGVGNTAKNSRVRGATRASLLKRTGRK 80 
72548811    1 MTRAGMKGKVLGKEKKAAIIDARKKAAESRKNRDDKRWKRVLANMDEEKRKKFHGVGNTAKNSRVRGATRASLLKRTGRK 80 
146101529   1 -----MKGKVLGKEKKAAIIDARKKDAESRKNRDDKRWKRVLANMDEEKRKKFHGVGNTAKNSRVRGATRASLRKRTGRK 75 
154344967   1 MTRAGMKGKVLGKEKKIAIIDARKKAVESRRSRDDKRWKRVIARMDEEKRKRFHGVGNTAKNSRARGTTRASLRKRTGRK 80 
154344969   1 MTRAGMKGKVLGKEKKIAIIDARKKAVESRRSRDDKRWKRVIARMDEEKRKRFHGVGNTAKNSRARGTTRASLRKRTGRK 80 
71413116   81 PDNITMEATIHLSKLLKRKTFHKRAPIAIKRIKAFVARLMKTKDNRIDASLNTYVWHKGVKGVPGRVRVHVERKSETLEG 160
71411582   81 PDNITMEATIHLSKLLKRKTFHKRAPIAIKRIKAFVARLMKTKDNRIDASLNTYVWHKGVKGVPGRVRVHVERKSETLEG 160
71411570   81 PDNITMEATIHLSKLLKRKTFHKRAPIAIKRIKAFVARLMKTKDNRIDASLNTYVWHKGVKGVPGRVRVHVERKSETLEG 160
71413124   81 PDNITMEATIHLSKLLKRKTFHKRAPIAIKRIKAFVARLMKTKDNRIDASLNTYVWHKGVKGVPGRVRVHVERKSETLEG 160
71745682   81 PDNIVMEASIHLSKLLKKRTFHKRAPIAIKRIRSFVGKLMKTKDNRIDASLNTFIWHKGVKGVPGRVRVRVERKSETMEG 160
71745684   81 PDNIVMEASIHLSKLLKKRTFHKRAPIAIKRIRSFVGKLMKTKDNRIDASLNTFIWHKGVKGVPGRVRVRVERKSETMEG 160
72548801   81 PDAVSMEATIHLSKLLKKKTFSKRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLIQRKSETTEG 160
72548811   81 PDAVSMEATIHLSKLLKKKTFSKRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLIQRKSETTEG 160
146101529  76 PDAVSMEATIHLSKLLKKKTFSKRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLIQRKSETTEG 155
154344967  81 PDAVSMEATIHLSKLLKKKTFAKRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLIQRKSETAEG 160
154344969  81 PDAVSMEATIHLSKLLKKKTFAKRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLIQRKSETAEG 160
71413116  161 GKRKHFYTVISNVPVASFKNLTTKVTEQ 188
71411582  161 GKRKHFYTVISNVPVASFKNLTTKVTEQ 188
71411570  161 GKRKHFYTVISNVPVASFKNLTTKVTEQ 188
71413124  161 GKRKHFYTVISNVPVASFKNLTTKVTEQ 188
71745682  161 GKRKHFYTVISHIPVPSFKNLTTKVIEQ 188
71745684  161 GKRKHFYTVISHIPVPSFKNLTTKVIEQ 188
72548801  161 NKHKHFYTVISNVPVASFKGLTTKTVEQ 188
72548811  161 NKHKHFYTVISNVPVASFKGLTTKTVEQ 188
146101529 156 NKHKHFYTVISNVPVASFKGLTTKTVEQ 183
154344967 161 NKHKHFFTVISNVPVASFKGLTTKTVEQ 188
154344969 161 NKHKHFFTVISNVPVASFKGLTTKTVEQ 188
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap