Conserved Protein Domain Family
PTZ00192

?
PTZ00192: PTZ00192 
60S ribosomal protein L13; Provisional
Statistics
?
PSSM-Id: 173472
View PSSM: PTZ00192
Aligned: 14 rows
Threshold Bit Score: 236.36
Threshold Setting Gi: 145508275
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71418780    1 MPKGKNAIPHVHQRKHWNPCSSQKGNVKVFLNQPAQKLRRRRLRLLKAKKTFPRPLKALRPQVNCPTVRHNMKKRLGRGF 80 
71660719    1 MPKGKNAIPHVHQRKHWNPCSSQKGNVKVFLNQPAQKLRRRRLRLLKAKKTFPRPLKALRPQVNCPTVRHNMKKRLGRGF 80 
71660721    1 MPKGKNAIPHVHQRKHWNPCSSQKGNVKVFLNQPAQKLRRRRLRLLKAKKTFPRPLKALRPQVNCPTVRHNMKKRLGRGF 80 
72386999   12 MPKGNNAIPHVHQRKHWNPCSSQKGNVKVFFNQPAQKQRRRRLRLLKAKKIFPRPLKALRPQVNCPTVRYNMKRRLGRGF 91 
72387001    1 MPKGNNAIPHVHQRKHWNPCSSQKGNVKVFFNQPAQKQRRRRLRLLKAKKIFPRPLKALRPQVNCPTVRYNMKRRLGRGF 80 
73536985    1 MPKGNNAIPHVHQKKHWNPCSSQKGNVKVFLNQPAQKHRRRRLRLLKAKKVFPRPLKALRPQVNCPTVRHNMKRRLGRGF 80 
73536987    1 MPKGNNAIPHVHQKKHWNPCSSQKGNVKVFLNQPAQKHRRRRLRLLKAKKVFPRPLKALRPQVNCPTVRHNMKRRLGRGF 80 
146093335   1 MPKGNNAIPHVHQKKHWNPCSSQKGNVKVFLNQPAQKHRRRRLRLLKAKKVFPRPLKALRPQVNCPTVRHNMKRRLGRGF 80 
146093337   1 MPKGNNAIPHVHQKKHWNPCSSQKGNVKVFLNQPAQKHRRRRLRLLKAKKVFPRPLKALRPQVNCPTVRHNMKRRLGRGF 80 
145483921   1 -MKHNQQLPNAHMRKHWTRF------VKTFYNQPAAKRRRQLRRRTQALSASPRPVELLRPVVRGQTIKYNNVQKLGRGF 73 
71418780   81 TVEELKAAGINPRFAPTIGIRVDRRRKNKSEEGMSINIQRLKTYMSKLVLFPMSYKNVQKGEATEEEVKSATQDRTRFGT 160
71660719   81 TVEELKAAGINPRFAPTIGIRVDRRRKNKSEEGMSINIQRLKTYMSKLVLFPMSYKNVQKGEATEEEVKSATQDRTRFGT 160
71660721   81 TVEELKAAGINPRFAPTIGIRVDRRRKNKSEEGMSINIQRLKTYMSKLVLFPMSYKNVQKGEATEEEVKSATQDRTRFGT 160
72386999   92 SLEELKAAGVKPRYARTIGIRVDRRRKNKSEEGMNINVQRLKTYMSKLVLFPLNRKKPQKGDATEEEVKAATQDRSRYGT 171
72387001   81 SLEELKAAGVKPRYARTIGIRVDRRRKNKSEEGMNINVQRLKTYMSKLVLFPLNRKKPQKGDATEEEVKAATQDRSRYGT 160
73536985   81 SPAELKAAGLNPQYAATIGIRVDSRRKNKSEEGMNVNVQRLKTYMSKLVLFPMNHKKVQKGEASEEEVKAATQDRSRFGD 160
73536987   81 SPAELKAAGLNPQYAATIGIRVDSRRKNKSEEGMNVNVQRLKTYMSKLVLFPMNHKKVQKGEASEEEVKAATQDRSRFGD 160
146093335  81 SPAELKAAGLNPQYAATIGIRVDSRRKNKSEEGMNVNVQRLKTYMSKLVLFPMNHKKVQKGEASEEEVKAATQDRSRFGD 160
146093337  81 SPAELKAAGLNPQYAATIGIRVDSRRKNKSEEGMNVNVQRLKTYMSKLVLFPMNHKKVQKGEASEEEVKAATQDRSRFGD 160
145483921  74 SLIELKEAGLNAAFARTIGISVDHRRRNLNQEELTSNVKRIKAYLSKLVLYPRVAGKPKNGVVKDSANEVVAHPVAQNTN 153
71418780  161 AAVGGFV-TPAPEAPRKVTEEERTKNVYKFLKKNHSAVRFFGIRRARQERREAKENEKK 218
71660719  161 AAVGGFV-TPAPEAPRKVTEEERTKNVYKFLKKNHSAVRFFGIRRARQERREAKENEKK 218
71660721  161 AAVGGFV-TPAPEAPRKVTEEERTKNVYKFLKKNHSAVRFFGIRRARQERREAKENEKK 218
72386999  172 AAVGGLV-TPAREAPRKVTEEESTKKMYKFLKKNHSAVRFFRARNRRAARKEAKENEKK 229
72387001  161 AAVGGLV-TPAREAPRKVTEEESTKKMYKFLKKNHSAVRFFRARNRRAARKEAKENEKK 218
73536985  161 AAVGAVV-YPSAEAPRAVSAEEKSMCVYAFLKKNHSAVRFFGTNSSRAARKEAAKEEKT 218
73536987  161 AAVGAVV-YPSAEAPRAVSAEEKSMCVYAFLKKNHSAVRFFGVRSARAARKEAAKEEKT 218
146093335 161 AAVGAVV-YPSAETPRAVSAEEKSMCVYAFLKKNHSAVRFFGARSARAARKEAAKEEKA 218
146093337 161 AAVGAVV-YPSAETPRAVSAEEKSMCVYAFLKKNHSAVRFFGARSARAARKEAAKEEKA 218
145483921 154 PEVITFQrTPKREKATVISKELRAKSVYRKLRQEWYNAKFVGVKEKRKQAKETKK---- 208
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap