Conserved Protein Domain Family
PTZ00186

?
PTZ00186: PTZ00186 
heat shock 70 kDa precursor protein; Provisional
Statistics
?
PSSM-Id: 140213
View PSSM: PTZ00186
Aligned: 15 rows
Threshold Bit Score: 1313.14
Threshold Setting Gi: 146093964
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71407515    1 MFARRLCGAGSLAAASLARWQSSKVTGDVIGIDLGTTYSCVAVMEGDKPRVLENTEGFRTTPSVVAFKGQEKLVGLAAKR 80 
72390407    1 MLARRVCAPMCLASAPFARWQSSKVTGDVIGIDLGTTYSCVAVMEGDRPRVLENTEGFRTTPSVVAFKGQEKLVGLAAKR 80 
72390395    1 MLARRVCAPMCLASAPFARWQSSKVTGDVIGIDLGTTYSCVAVMEGDRPRVLENTEGFRTTPSVVAFKGQEKLVGLAAKR 80 
146093964   1 MFARRVCGSAAASAARLARHESQKVQGDVIGVDLGTTYSCVATMDGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKR 80 
146093974   1 MFARRVCGSAAASAARLARHESQKVQGDVIGVDLGTTYSCVATMDGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKR 80 
154341833   1 MFARRVCGGAAVSAARLVRCESQKVTGDVIGVDLGTTYSCVATMDGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKR 80 
154341837   1 MFARRVCGGAAVSAARLVRCESQKVTGDVIGVDLGTTYSCVATMDGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKR 80 
157872646   1 MFARRVCGSAAASAACLARHESQKVQGDVIGVDLGTTYSCVATMDGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKR 80 
157872629   1 MFARRVCGSAAASAACLARHESQKVQGDVIGVDLGTTYSCVATMDGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKR 80 
157872633   1 MFARRVCGSAAASAACLARHESQKVQGDVIGVDLGTTYSCVATMDGDKARVLENSEGFRTTPSVVAFKGSEKLVGLAAKR 80 
71407515   81 QAITNPQSTFFAVKRLIGRRFEDSNIQHDIKNVPYKIVRSSNGDAWVQDANGKQYSPSQVGAFVLEKMKETAENFLGRKV 160
72390407   81 QAITNPQSTFFAVKRLIGRRFDDEHIQHDIKNVPYKIIRSNNGDAWVQDGNGKQYSPSQVGAFVLEKMKETAENFLGRKV 160
72390395   81 QAITNPQSTFFAVKRLIGRRFDDEHIQHDIKNVPYKIIRSNNGDAWVQDGNGKQYSPSQVGAFVLEKMKETAENFLGRKV 160
146093964  81 QAITNPQSTFYAVKRLIGRRFEDEHIQKDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQIGAFVLEKMKETAENFLGHKV 160
146093974  81 QAITNPQSTFYAVKRLIGRRFEDEHIQKDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQIGAFVLEKMKETAENFLGHKV 160
154341833  81 QAITNPQSTFYAVKRLIGRRFEDEHIQRDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQVGAFVLEKMKETAQNFLGHTV 160
154341837  81 QAITNPQSTFYAVKRLIGRRFEDEHIQRDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQVGAFVLEKMKETAQNFLGHTV 160
157872646  81 QAITNPQSTFYAVKRLIGRRFEDEHIQKDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQIGAFVLEKMKETAENFLGHKV 160
157872629  81 QAITNPQSTFYAVKRLIGRRFEDEHIQKDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQIGAFVLEKMKETAENFLGHKV 160
157872633  81 QAITNPQSTFYAVKRLIGRRFEDEHIQKDIKNVPYKIVRAGNGDAWVQDGNGKQYSPSQIGAFVLEKMKETAENFLGHKV 160
71407515  161 SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGLDKTKDSMIAVYDLGGGTFDISVLEIAGGVFEVKA 240
72390407  161 SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGLDKTKDSLIAVYDLGGGTFDISVLEIAGGVFEVKA 240
72390395  161 SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGLDKTKDSLIAVYDLGGGTFDISVLEIAGGVFEVKA 240
146093964 161 SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYDLGGGTFDISVLEIAGGVFEVKA 240
146093974 161 SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYDLGGGTFDISVLEIAGGVFEVKA 240
154341833 161 SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYDLGGGTFDISVLEIAGGVFEVKA 240
154341837 161 SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYDLGGGTFDISVLEIAGGVFEVKA 240
157872646 161 SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYDLGGGTFDISVLEIAGGVFEVKA 240
157872629 161 SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYDLGGGTFDISVLEIAGGVFEVKA 240
157872633 161 SNAVVTCPAYFNDAQRQATKDAGTIAGLNVIRVVNEPTAAALAYGMDKTKDSLIAVYDLGGGTFDISVLEIAGGVFEVKA 240
71407515  241 TNGDTHLGGEDFDLCLSDYILTEFKKSTGIDLSNERMALQRIREAAEKAKCELSTTMETEVNLPFITANQDGAQHVQMTV 320
72390407  241 TNGDTHLGGEDFDLCLSDHILEEFRKTSGIDLSKERMALQRIREAAEKAKCELSTTMETEVNLPFITANQDGAQHVQMMV 320
72390395  241 TNGDTHLGGEDFDLCLSDHILEEFRKTSGIDLSKERMALQRIREAAEKAKCELSTTMETEVNLPFITANQDGAQHVQMMV 320
146093964 241 TNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKERMALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMHI 320
146093974 241 TNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKERMALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMRI 320
154341833 241 TNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKERMALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMHI 320
154341837 241 TNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKERMALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMHI 320
157872646 241 TNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKERMALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMHI 320
157872629 241 TNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKERMALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMHI 320
157872633 241 TNGDTHLGGEDFDLALSDYILEEFRKTSGIDLSKERMALQRVREAAEKAKCELSSAMETEVNLPFITANADGAQHIQMHI 320
71407515  321 SRSKFESLAEKLVQRSLGPCKQCIKDAAVDLKEISEVVLVGGMTRMPKVIEAVKQFFGRDPFRGVNPDEAVALGAATLGG 400
72390407  321 SRSKFESLADKLVQRSLGPCKQCIKDAAVDLKEISEVVLVGGMTRMPKVVEAVKQFFGREPFRGVNPDEAVALGAATLGG 400
72390395  321 SRSKFESLADKLVQRSLGPCKQCIKDAAVDLKEISEVVLVGGMTRMPKVVEAVKQFFGREPFRGVNPDEAVALGAATLGG 400
146093964 321 SRSKFEGITQRLIERSIAPCKQCMKDAGVELREINDVVLVGGMTRMPKVVEEVKKFFQKDPFRGVNPDEAVALGAATLGG 400
146093974 321 SRSKFEGITQRLIDRSIAPCKQCMKDAGVELKEINDVVLVGGMTRMPKVVEEVKKFFQKDPFRGVNPDEAVALGAATLGG 400
154341833 321 SRSKFEGITTRLIERSIAPCKQCIKDAGVELKEINDVVLVGGMTRMPKVVEEVKRFFQKEPFRGVNPDEAVALGAATLGG 400
154341837 321 SRSKFEGITTRLIERSIAPCKQCIKDAGVELKEINDVVLVGGMTRMPKVVEEVKRFFQKEPFRGVNPDEAVALGAATLGG 400
157872646 321 SRSKFEGITQRLIDRSIAPCKQCMKDAGVELKEINDVVLVGGMTRMPKVVEEVKKFFQKDPFRGVNPDEAVALGAATLGG 400
157872629 321 SRSKFEGITQRLIERSIAPCKQCMKDAGVELKEINDVVLVGGMTRMPKVVEEVKKFFQKDPFRGVNPDEAVALGAATLGG 400
157872633 321 SRSKFEGITQRLIERSIAPCKQCMKDAGVELKEINDVVLVGGMTRMPKVVEEVKKFFQKDPFRGVNPDEAVALGAATLGG 400
71407515  401 VLRGDVKGLVLLDVTPLSLGIETLGGVFTRMIPKNTTIPTKKSQTFSTAADNQTQVGIKVFQGEREMAADNQMMGQFDLV 480
72390407  401 VLRGDVKGLVLLDVTPLSLGIETLGGVFTRMIPKNTTIPTKKSQTFSTAADNQTQVGIKVFQGEREMASDNQMMGQFDLV 480
72390395  401 VLRGDVKGLVLLDVTPLSLGIETLGGVFTRMIPKNTTIPTKKSQTFSTAADNQTQVGIKVFQGEREMASDNQMMGQFDLV 480
146093964 401 VLRGKVSGLILVDVTPLSLGTSVVGDVFVPIIPRNTAIPCTRSHIFTTVDDGQTAIKFQVFQGEREVASKNQMMGQFDLS 480
146093974 401 VLRGDVKGLVLLDVTPLSLGIETLGGVFTRMIPKNTTIPTKKSQTFSTAADNQTQVGIKVFQGEREMAADNQMMGQFDLV 480
154341833 401 VLRGDVKGLVLLDVTPLSLGIETLGGVFTRMIPKNTTIPTKKSQTFSTAADNQTQVGIKVFQGEREMAADNQMMGQFDLV 480
154341837 401 VLRGDVKGLVLLDVTPLSLGIETLGGVFTRMIPKNTTIPTKKSQTFSTAADNQTQVGIKVFQGEREMAADNQMMGQFDLV 480
157872646 401 VLRGDVKGLVLLDVTPLSLGIETLGGVFTRMIPKNTTIPTKKSQTFSTAADNQTQVGIKVFQGEREMAADNQMMGQFDLV 480
157872629 401 VLRGKASDLILVDVTPLSLGTSVVGDVFTRMIPKNTTIPCMRSHIFTTVDDGQTAIKFKVFQGEREIASENQIRGEFDLS 480
157872633 401 VLRGDVKGLVLLDVTPLSLGIETLGGVFTRMIPKNTTIPTKKSQTFSTAADNQTQVGIKVFQGEREMAADNQMMGQFDLV 480
71407515  481 GIPPAPRGVPQIEVTFDIDANGICHVTAKDKATGKTQNITITASGGLSKEQIERMIRDSESHAESDRLKRELVEVRNNAE 560
72390407  481 GIPPAPRGVPQIEVTFDIDANGICHVTAKDKATGKTQNITITAHGGLTKEQIENMIRDSEMHAEADRVKRELVEVRNNAE 560
72390395  481 GIPPAPRGVPQIEVTFDIDANGICHVTAKDKATGKTQNITITAHGGLTKEQIENMIRDSEMHAEADRVKRELVEVRNNAE 560
146093964 481 GIAYAPRGVPQIEVTFDIDANGICHVTAQDKATGRKQGIIVTANGGLSENDIERMLRDAAQHAEADRVKRELVEVRNNAE 560
146093974 481 GIPPAPRGVPQIEVTFDIDANGICHVTAKDKATGKTQNITITANGGLSKEQIEQMIRDSEQHAEADRVKRELVEVRNNAE 560
154341833 481 GIPPAPRGVPQVEVTFDIDANGICHVTAKDKATGKTQNITITAHGGLSKEQIEQMVRDSEQHAEADRVKRELVEARNNAE 560
154341837 481 GIPPAPRGVPQVEVTFDIDANGICHVTAKDKATGKTQNITITAHGGLSKEQIEQMVRDSEQHAEADRVKRELVEARNNAE 560
157872646 481 GIPPAPRGVPQVEVTFDIDANGICHVTAKDKATGKTQNITITANGGLSKEQIEQMIRDSEQHAEADRVKRELVEVRNNAE 560
157872629 481 GIPPAPRGVPQIEVTFDIDANGICHVTAKDKATGKTQNITITANGGLSKEQIEQMIRDSEQHAEADRVKRELVEVRNNAE 560
157872633 481 GIPPAPRGVPQVEVTFDIDANGICHVTAKDKATGKTQNITITANGGLSKEQIEQMIRDSEQHAEADRVKRELVEVRNNAE 560
71407515  561 TQANTAERQLTEWKYVSDAEKENVRTLLAELRKSMENPNVTKDELSAATDKLQKAVMECGRTEYQQAAAANSSSSSGNTD 640
72390407  561 TQANTAERQLTEWKYVTDAEKENVRTLLAELRKVMENPNVTKDELSASTDKLQKAVMECGRTEYQQAAAANSGSSGSSST 640
72390395  561 TQANTAERQLTEWKYVTDAEKENVRTLLAELRKVMENPNVTKDELSASTDKLQKAVMECGRTEYQQAAAANSGSSGSSST 640
146093964 561 TQLTTAERQLGEWKYVSDAEKENVKTLVAELRKAMENPNVAKDDLAAATDKLQKAVMECGRTEYQQAAAAYSGNS----- 635
146093974 561 TQLTTAERQLGEWKYVSDAEKENVKTLVAELRKAMENPNVAKDDLAAATDKLQKAVMECGRTEYQQAAAANSGSTSNSGE 640
154341833 561 TQLTTAERQLGEWKYVSDAEKENVKTHVAELRKAMENPNVAKDDLAAATDKLQKAVMECGRTEYQQAAAANSGSSSNSGE 640
154341837 561 TQLTTAERQLGEWKYVSDAEKENVKTHVAELRKAMENPNVAKDDLVAATDKLQKAVMECGRTEYQQAAAANSGSSSNSGE 640
157872646 561 TQLTTAERQLGEWKYVSDAEKENVKTLVAELRKAMENPNVAKDDLAAATDKLQKAVMECGRTEYQQAAAANSGSTSNSGE 640
157872629 561 TQLTTAERQLGEWKYVSDAEKENVKTLVAELRKAMENPNVAKDDLAAATDKLQKAVMECGRTEYQQAAAANSGQC----- 635
157872633 561 TQLTTAERQLGEWKYVSDAEKENVKTLVAELRKAMENPNVAKDDLAAATDKLQKAVMECGRTEYQQAAAANSGSTSNSGE 640
71407515  641 SSQG-------EQQQQGDQQKQ 655
72390407  641 EGQGe-----qQQQQASGEKKE 657
72390395  641 EGQGe-----qQQQQASGEKKE 657
146093964     ----------------------    
146093974 641 QQQQqgq-geqQQQQSQGEETK 661
154341833 641 -----------QQQQQQSSEKN 651
154341837 641 QQQQqq----gDQQQQQNSEKK 658
157872646 641 Q----------QQQQSQGEETK 652
157872629     ----------------------    
157872633 641 QQQQqsqgeqqQQQQQNSEEKK 662
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap