Conserved Protein Domain Family
PTZ00185

?
PTZ00185: PTZ00185 
ATPase alpha subunit; Provisional
Statistics
?
PSSM-Id: 140212
View PSSM: PTZ00185
Aligned: 6 rows
Threshold Bit Score: 1043.85
Threshold Setting Gi: 72392136
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72392136    1 MRRFGSKFASGLASRCAlacplasaatapAGASTTSSTSSAQKSFFKTTEMIGYVHSIDGTIATLIPAPGNPGVAYNTII 80 
72392138    1 MRRFGSKFASGLASRCAlacplasaatapAGASTTSSTSSAQKSFFKTTEMIGYVHSIDGTIATLIPAPGNPGVAYNTII 80 
146076833   1 MRRFVAQYVAPAMGRLA------------STAAAGKSAAPGQKSFFKATEMIGYVHSIDGTIATLIPAPGNPGVAYNTII 68 
154332099   1 MRRFVAQHMAPAVARLA------------STAAASKSAAPGQKSFFKATEMIGYVHSIDGTIATLIPAPGNPGVAYNTII 68 
157863955   1 MRRFVAQYVAPAMGRLA------------STAAAGKSAAPGQKSFFKATEMIGYVHSIDGTIATLIPAPGNPGVAYNTII 68 
157863958   1 MRRFVAQYVAPAMGRLA------------STAAAGKSAAPGQKSFFKATEMIGYVHSIDGTIATLIPAPGNPGVAYNTII 68 
72392136   81 QIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQSGQKVMATGQLLHIPVGAGVLGKVVNPLGHEVPVGLVTRSRRLLD 160
72392138   81 QIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQSGQKVMATGQLLHIPVGAGVLGKVVNPLGHEVPVGLVTRSRRLLD 160
146076833  69 MIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQSGQKVMATGKLLYIPVGAGVLGKVVNPLGHEVPVGLLTRSRALLE 148
154332099  69 MIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQSGQKVMATGKLLYIPVGTGVLGKVVNPLGHEVPVGLFTRSRALLE 148
157863955  69 MIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQSGQKVMATGKLLYIPVGAGVLGKVVNPLGHEVPVGLLTRSRALLE 148
157863958  69 MIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQSGQKVMATGKLLYIPVGAGVLGKVVNPLGHEVPVGLLTRSRALLE 148
72392136  161 S--TLGKVDTGAPNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRINQQILSKNAVIS 238
72392138  161 S--TLGKVDTGAPNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRINQQILSKNAVIS 238
146076833 149 SeqTLGKVDAGAPNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRSNQQILSKNAVIS 228
154332099 149 SeqTLGKVDAGAPNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRINQQILSKNAVIS 228
157863955 149 SeqTLGKVDAGAPNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRSNQQILSKNAVIS 228
157863958 149 SeqTLGKVDAGAPNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRSNQQILSKNAVIS 228
72392136  239 IYVSIGQRCSNVARIHRLLQSYGALRYTTVMAATAAEPAGLQYLAPYAGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQI 318
72392138  239 IYVSIGQRCSNVARIHRLLQSYGALRYTTVMAATAAEPAGLQYLAPYAGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQI 318
146076833 229 IYVSIGQRCSNVARIHRLLRSYGALRYTTVMAATAAEPAGLQYLAPYSGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQI 308
154332099 229 IYVSIGQRCSNVARIHRLLRSYGALRYTTVMAATAAEPAGLQYLAPYSGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQI 308
157863955 229 IYVSIGQRCSNVARIHRLLRSYGALRYTTVMAATAAEPAGLQYLAPYSGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQI 308
157863958 229 IYVSIGQRCSNVARIHRLLRSYGALRYTTVMAATAAEPAGLQYLAPYSGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQI 308
72392136  319 SLLLRRPPGREAYPGDVFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQ 398
72392138  319 SLLLRRPPGREAYPGDVFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQ 398
146076833 309 SLLLRRPPGREAYPGDVFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQ 388
154332099 309 SLLLRRPPGREAYPGDVFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQ 388
157863955 309 SLLLRRPPGREAYPGDVFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQ 388
157863958 309 SLLLRRPPGREAYPGDVFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQ 388
72392136  399 RPAVNIGLSVSRVGSSAQNAAMKGVAGKLKGILAEYRKLAADSVGGQQVQTIPMIRGARFVALFNQKQPSYFMNAIVSLY 478
72392138  399 RPAVNIGLSVSRVGSSAQNAAMKGVAGKLKGILAEYRKLAADSVGGQQVQTIPMIRGARFVALFNQKQPSYFMNAIVSLY 478
146076833 389 RPAVNIGLSVSRVGSSAQNVAMKAVAGKLKGILAEYRKLAADSVGGSQVQTVPMIRGARFVALFNQKNPSFFMNALVSLY 468
154332099 389 RPAVNIGLSVSRVGSSAQNVAMKAVAGKLKGILAEYRKLAADSVGGSQVQTVPMIRGARFVALFNQKNPSFFMNALVSLY 468
157863955 389 RPAVNIGLSVSRVGSSAQNVAMKAVAGKLKGILAEYRKLAADSVGGSQVQTVPMIRGARFVALFNQKNPSFFMNALVSLY 468
157863958 389 RPAVNIGLSVSRVGSSAQNVAMKAVAGKLKGILAEYRKLAADSVGGSQVQTVPMIRGARFVALFNQKNPSFFMNALVSLY 468
72392136  479 ACLNGYLDDVKVQYVKFYEYLLVHRDLGIMYGTAKNKFFYMYVQELNYLIRFFTLNSPILHGELEEMLKQHTHLFLQHYQ 558
72392138  479 ACLNGYLDDVKVQYVKFYEYLLVHRDLGIMYGTAKNKFFYMYVQELNYLIRFFTLNSPILHGELEEMLKQHTHLFLQHYQ 558
146076833 469 ACLNGYLDDVKVNYAKLYEYLLVNKDLSVMYGTATNKFFYMYVQQLNYVIRFFTLNHPILNAEVEEMLKQHTHLFLQHYQ 548
154332099 469 ACLNGYLDDVKVNYAKLYEYLLVNKDLSVMYGTATNKFFYMYVQQLNYVIRFFTLSHPVLNAEVEEMLKQHTHLFLQHYQ 548
157863955 469 ACLNGYLDDVKVNYAKLYEYLLVNKDLSVMYGTATNKFFYMYVQQLNYVIRFFTLNHPILNAEVEEMLKQHTHLFLQHYQ 548
157863958 469 ACLNGYLDDVKVNYAKLYEYLLVNKDLSVMYGTATNKFFYMYVQQLNYVIRFFTLNHPILNAEVEEMLKQHTHLFLQHYQ 548
72392136  559 SKMNAIKSEKDVKALKNLLYSCKRAV 584
72392138  559 SKMNAIKSEKDVKALKNLLYSCKRAV 584
146076833 549 SKMNAIKTEKEIKALKNLLYSCKRAV 574
154332099 549 SKMNAIKTEKEIKALKNLLYSCKRAV 574
157863955 549 SKMNAIKTEKEIKALKNLLYSCKRAV 574
157863958 549 SKMNAIKTEKEIKALKNLLYSCKRAV 574
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap