Conserved Protein Domain Family
PTZ00180

?
PTZ00180: PTZ00180 
60S ribosomal protein L8; Provisional
Statistics
?
PSSM-Id: 173464
View PSSM: PTZ00180
Aligned: 33 rows
Threshold Bit Score: 444.176
Threshold Setting Gi: 159107959
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145519223  14 MGKRIRTQRKGKSNsVFKAHQNQRVGSPQYRHLDYAERHGYVRGVISEIIHDPGRGAPLAKVEFNDPYKYKKQTKLFIAP 93 
209879876   1 MGRVIRGQRKGAGS-VFKSKVSKRRGPVKLRALDFIERHGYIKGLVKDITTDPGRGCPVAHITFRDPYRYKLQKELMIAV 79 
146185506   1 MGRVIRAQRKGRANgVYKSHKSGRIAPAQYRVYDFAERQGYIRGCIRDIVHEPGRGAPLAEVAFRDPYRYKTNKEHFIAA 80 
124506257   1 MGRVIRGQRKGRGS-IFKSHNHHRKGAAKLRHLDYCEKKGYIKGLVKDIIHDPGRGAPLAKVIFKRTEKYGKKEELIIAS 79 
156089787   1 MGRIIRGQRKGRGS-IFKSHVHLRKGPAKLRRFDYAENHGYIRGVVKDIIHDSGRGAPLAQIHFRNAYKYRTDKEQVVAV 79 
156095508   1 MGRVIRGQRKGRGS-IFKSHNHHRKGAAKLRHLDFCEKKGYIKGLIKDIIHDPGRGAPLAKIVFKKTEKYGKKEELMVAT 79 
84998006    1 MGRVIRSQRKGRGS-VFRAHTHKRKGAVKLRRLDYAETHGYIRGVVKDIVHDPGRGAPLAKVVFRNAYKYGLDRELFVAV 79 
66362842    1 MGRVIRGQRKGAGS-IFKAKVSKRRGPVKLRALDYIERHGYIKGLVKDITTDPGRGCPVAHVSFRDPYRYKIKKELMIAV 79 
221057019   1 MGRVIRGQRKGRGS-IFKSHNHHRKGAAKLRHLDFCEKKGYIKGLIKDIIHDPGRGAPLAKVVFKKTEKYGKKEELMVAT 79 
237836773   1 MGRVIRAQRKGRGS-VFRAHTHKRKGEAKLRPLDFAERRGYIKGLVKDILHDPGRGAPLAEVSFRDAYRYKLNKQRMVAV 79 
145519223  94 EGAYTGQYIYCGAKAQLATGNVLPIGSIPEGTVVCNLEEHPGDKGALGRATGCYATIIGHSDDGAQTRVRLPSGTRKTLS 173
209879876  80 EGLHTGQFVYCGKNATLSVGNILPVGKIPEGTIIASCEEKAGDRGKLARTSGTYAIVVGQSEDGKKTRIRLPSGARKTIN 159
146185506  81 EGQYSGQYVYCGLKAQIAVGNVLPINRIPEGTVVCNVEEKVGDRGTFSRASGCYATIIGHSEDGDKTRIRLPSGARKTIP 160
124506257  80 EGMFTGQYISCGTKAPLSVGNILPIGKMPEGTLICNLEHRTGNRGTLVKASGCYATVVGQSEDGKKTKVRLPSGAKKTID 159
156089787  80 EGMYTGQYVYFGRESRLNIGNCMPVGKMPEGTVISSLEEKRGDRGRLAKASGTYATIIGHSDDGKMTRVRLPSGARKSVE 159
156095508  80 EGMFTGQYISCGIKAPLSVGNILPIGKMPEGTLICNLEHRTGNRGTLVKASGCYATVVGQSEDGKKTKVRLPSGAKKTID 159
84998006   80 EGLYTGQFVYFGSNASLAVGNCLPLGKMPEGTVVSCLEEKKGDRGRVAKTSGSYATVISHSDDGKTTRIRLPSGTRKTVS 159
66362842   80 EGLHTGQFVYCGKNATLSVGNVLPVGQIPEGTIISSCEEKAGDRGKLARTSGTYAIIVGQSEDGTKTRIRLPSGARKTIS 159
221057019  80 EGMFTGQYISCGIKAPLSVGNILPIGKMPEGTLICNLEHRTGNRGTLAKASGCYATVVGQSEDGKKTKVRLPSGAKKTID 159
237836773  80 EGMYTGQFIYCGKNAALTIGNILPLNKMPEGTVVSNVEEKAGDRGTLARTSGTYATIVGHSDDGSKTRIRLPSGARKTVS 159
145519223 174 SLCRATVGLISGGGRTEKPILKAGRQFHKYRRLRKVWPRVRGVAMNPVDHPHGGGNQQHIGHPSTLSRYAPPGQKVGLVA 253
209879876 160 SQSRAIIGIVAAGGRIDKPVLKAGNNYHKYKVKRNCWPKVRGVSMNPVDHPHGGGNHQHIGHPSTVSRSAPPGQKVGLIA 239
146185506 161 GSCRATVGIVAGGGRTDKPILKAGNQFHKYARKRKSWPRVRGVAMNPVDHPHGGGNHQHIGHPATVSKWASAGQKVGLRA 240
124506257 160 AKARAMVGVVGAGGRIDKPILKAGVAHHKYRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHPSTVSRSAPAGQKVGLIA 239
156089787 160 SNSRAIIGLVAGGGRIDKPLLKAGTAYFKYKAKRNCWPRVRGVTMNPVDHPHGGGNHQHIGKPSTVSRGAPPGQKVGLIA 239
156095508 160 ARARAMVGVVGAGGRIDKPILKAGVAHHKYRVKRNCWPKVRGVAMNPVDHPHGGGNHQHIGHPSTVSRSAPAGQKVGLIA 239
84998006  160 SAARGIVGVVAGGGRIDKPLLKAGVSYHKYKAKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHPSTISRLAPPGQKVGLIA 239
66362842  160 SQSRAIIGIVAAGGRIDKPVLKAGNNYHKYKVKRNCWPKVRGVSMNPVDHPHGGGNHQHIGHPSTVSRSAPPGQKVGLIA 239
221057019 160 SRARAMVGVVGAGGRIDKPILKAGVAHHKYRVKRNCWPKVRGVAMNPVDHPHGGGNHQHIGHPSTVSRSAPAGQKVGLIA 239
237836773 160 GYSRGMVGIVAGGGRIDKPMLKAGNAYHKYKVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHPSTVSRMAAPGQKVGLIA 239
145519223 254 ARRSGLLRGGAQLKQMDEDLA 274
209879876 240 ARRTGLLRGGRKTTKDRAEKT 260
146185506 241 ARRTGLVRGGQKEKMAMKAAA 261
124506257 240 ARRTGLLRGAKKTKLVGKSEE 260
156089787 240 ARRTGLLRGGKKKFKNES--- 257
156095508 240 ARRTGLLRGAKKTKLVGKTED 260
84998006  240 ARRTGLLRGSKKKKFAKES-- 258
66362842  240 ARRTGLLRGGRKTAKDKVEKG 260
221057019 240 ARRTGLLRGAKKTKLVGKTED 260
237836773 240 ARRTGLLRGGRKTKLAGKSQE 260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap