Conserved Protein Domain Family
PTZ00179

?
PTZ00179: PTZ00179 
60S ribosomal protein L9; Provisional
Statistics
?
PSSM-Id: 140206
View PSSM: PTZ00179
Aligned: 12 rows
Threshold Bit Score: 338.832
Threshold Setting Gi: 72390583
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71403977    1 MKIRAQDRITYPEDVELSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKFRTFTAVRWFGTKIDNSTINTALSHVRNMIT 80 
71407652    1 MKIRAQDRITYPEDVEVSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKFRTFTAVRWFGTKIDNSTINTALSHVRNMIT 80 
71746626    1 MKIKSHDQITFPEDVTVSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKLRTFTAVRWFGNKINNSTINTALSHVRNMIT 80 
71649657    1 MKIRAQDRITYPEDVELSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKFRTFTAVRWFGTKIDNSTINTALSHVRNMIT 80 
71661487    1 MKIRAQDRITYPEDVEVSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKFRTFTAVRWFGTKIDNSTINTALSHVRNMIT 80 
72390583    1 MKIKSHDQITFPEDVTVSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKLRTFTAVRWFGNKINNSTINTALSHVRNMIT 80 
146094152   2 VKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLDLRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVQNMIT 81 
146094260   2 VKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLDLRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVQNMIT 81 
154337200   2 VKIKSFSTLEIPEGVTVEVRGRKVTVTGKRGTLTKDLSHLQLDFRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVLNMIT 81 
154342021   2 VKIKSFSTLEIPEGVTVEVRGRKVTVTGKRGTLTKDLSHLQLDFRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVLNMIT 81 
157869010   2 VKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLDLRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVQNMIT 81 
157872833   2 VKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLDLRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVQNMIT 81 
71403977   81 GVTRGFRFKIRFAYAHFPISVSVENQLVEIRNFLGEKRVRRQVVADGVKVYRTDPTVVKDELVLEGNDLEEVSREAAVMH 160
71407652   81 GVTRGFRFKIRFAYAHFPISVSVENQLVEIRNFLGEKRVRRQVVADGVKVYRTDPTVVKDELVLEGNDLEEVSREAAVMH 160
71746626   81 GVTKGFRFKVRFAYAHFPISVTVENQLVEIRNFLGEKRVRRQVVADDVKVYRTDAALVKDELVLEGNDLEQVSREAAVMH 160
71649657   81 GVTRGFRFKIRFAYAHFPISVSVENQLVEIRNFLGEKRVRRQVVADGVKVYRTDPTVVKDELVLEGNDLEEVSREAAVMH 160
71661487   81 GVTRGFRFKIRFAYAHFPISVSVENQLVEIRNFLGEKRVRRQVVADGVKVYRTDPTVVKDELVLEGNDLEEVSREAAVMH 160
72390583   81 GVTKGFRFKVRFAYAHFPISVTVENQLVEIRNFLGEKRVRRQVVADDVKVYRTDAALVKDELVLEGNDLEQVSREAAVMH 160
146094152  82 GVTKGYRFKVRCAYAHFPINVSVDGQNIEVRNFLGEKRVRRQLVPSSVKVSQTDPSKVKDEIIFDGNDLEQVSREAAVLH 161
146094260  82 GVTKGYRFKVRCAYAHFPINVSVDGQNIEVRNFLGEKRVRRQLVPSSVKVSQTDPSKVKDEIIFDGNDLEQVSREAAVLH 161
154337200  82 GVTKGYRFKVRCAYAHFPINVSLDGPNIEVRNFLGEKRVRRQTVPSTVKVSQTDPSKVKDEIVFDGNDLEQVSREAAVLH 161
154342021  82 GVTKGYRFKVRCAYAHFPINVSLDGPNIEVRNFLGEKRVRRQTVPSTVKVSQTDPSKVKDEIVFDGNDLEQVSREAAVLH 161
157869010  82 GVTKGYRFKVRCAYAHFPINVSVDGQNIEVRNFLGEKRVRRQLVPNTVKVSQTDPSKVKDEIVFDGNDLEQVSREAAVLH 161
157872833  82 GVTKGYRFKVRCAYAHFPINVSVDGQNIEVRNFLGEKRVRRQLVPNTVKVSQTDPSKVKDEIVFDGNDLEQVSREAAVLH 161
71403977  161 QLCLVKKKDIRKFLDGIYVQTKTNVVTEE 189
71407652  161 QLCLVKKKDIRKFLDGIYVQTKTNVVAEE 189
71746626  161 QLCLVKKKDIRKFLDGIYVQTKTNIEVDE 189
71649657  161 QLCLVKKKDIRKFLDGIYVQTKTNVVAEE 189
71661487  161 QLCLVKKKDIRKFLDGIYVQTKTNVVAEE 189
72390583  161 QLCLVKKKDIRKVL-GRHLRADKDQHRS- 187
146094152 162 QMCLVKKKDIRKFLDGIYVQTKTNIEGAE 190
146094260 162 QMCLVKKKDIRKFLDGIYVQTKTNIEGME 190
154337200 162 QMCLVRKKDIRKFLDGIYVQTKTNVEAVE 190
154342021 162 QMCLVRKKDIRKFLDGIYVQTKTNVEAVE 190
157869010 162 QMCLVKKKDIRKFLDGIYVQTKTNIEGME 190
157872833 162 QMCLVKKKDIRKFLDGIYVQTKTNIEGTE 190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap