Conserved Protein Domain Family
PTZ00176

?
PTZ00176: PTZ00176 
erythrocyte membrane protein 1 (PfEMP1); Provisional
Statistics
?
PSSM-Id: 140204
View PSSM: PTZ00176
Aligned: 3 rows
Threshold Bit Score: 2496.82
Threshold Setting Gi: 124505649
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
86170351     9 GGNKSVNITESEKSARNVLEKIGRHIKDEINKNSNHTNKLKGTLSNAQFHDGLHKAAGWgVRYGPANSCDLEHRFYTNIN 88  
124505649    1 MALKKGVINESKLSARNVLENIANEIKVKRENERKYNDKLKGSLWEARFSDGLSSSFGD-IRSGYYDSCSLDHKFHTNIN 79  
124507287    1 MAPKNGSRNGKLLSLRDVLENIGSGIKDKRKNQSKYTDKLKGILTKAKFVDGLSSRYGY-VRDSDGISCNLSHKFHTNIT 79  
86170351    89 NGYLPARNPCHNRNQNRFDENAEAYCNSDKIRGNENNSNAGACAPFRRQNLCDKNLEYLINENTKTTHDLLGNVLVTAKY 168 
124505649   80 NGYPPARNPCDGRNQERFSNDGESKCGSDKIRGNENNSNAGACAPFRRQNMCDKNLEYLINKNTENTHDLLGNVLVTAKY 159 
124507287   80 --IEAARDPCYGREQNRFDENVESYCNNDKIRGSGKIFDGRVCVPPRRQHICDHNLEYLNNNNTDDTDDLLGNVLVTAKY 157 
86170351   169 EGDYIVNNHPNRG----SSEVCIALARSFADIGDIVRGKDMFKSN--DNVENGLREVFKKIYEGFLDKGAREHYKEVKNG 242 
124505649  160 EGESIVNNHPDKDikgnKSSICTSLARSFADIGDIIRGKDMFKRNkhDNIEKGLREVFKKIYEGLKNNGAREHYKEVKNG 239 
124507287  158 EGQSIVNNHPHKE----TSDVCTALARSFADIGDIVRGIDMFKPNdqDEVWNGLRSVFKKIHDNLSSE-VKNAYPDDGSG 232 
86170351   243 NYIKLREDWWTANRDQVWKAMTCVAPENAYFRKTEADGIGISSLILPYSKCGRDTDPPVVDYIPQRLRWMSEWSEYFCNV 322 
124505649  240 NYIKLREDWWTANRDQVWKAITCEAPENAYIIKRRIDGGDIENLILTHPKCGHDTDPPVVDYIPQRLRWMSEWSEYFCNV 319 
124507287  233 NYFKLREDWWTANRDQVWKAMTCVAPENAYFRKTEADGIGISSLILPYSKCGRDTDPPVVDYIPQRLRWMSEWSEYFCNV 312 
86170351   323 LNKEIDEMNNQCKDCEMSRRCNNDTEGEKCKKCKEQCQIFKELVSKWKNEFDKQSMKYKELYIKASTNITKQNSSSPERG 402 
124505649  320 LNKEIDEMNNQCKDCEMSRRCNNDTEGEKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKASTNITKQNSSAPERG 399 
124507287  313 LNKEIDEMNNQCKDCEMSRRCNDDSEGGKCKKCKEQCQIFKELVSKWKNQFDKQSMKYMELYNKASTNITKQNSSAPERG 392 
86170351   403 YRRNHRRRGYDDDTNVQLFLKKVIENNECKVESLGKYLDKTSHCGNYNFNYDNIPGSNRPNAFEIPPEKFKKACKCKIPN 482 
124505649  400 YRRNHRRRGYDDDTNVQLFLKKVIENNECKVESLGKYLDKTSHCGNYNFNYDNTPGSNRSNAFEITPEKFKKACKCKIPN 479 
124507287  393 YRRNHRRRGYDDDTNVQLFLKKVIENNECKVESLGKYLDKTSHCGNYNFNYDNTPGSNRSNAFEITPEKFKKACKCKIPN 472 
86170351   483 PLEKCPNEENKNVCTRFDKVSSCTSLFFKNDLIEWNNSGVKNKENDNNGVLVPPRRRNLCINLFSKKDYKMKDENDFKED 562 
124505649  480 PLEKCPNEENKNVCTRFDKVYSCTSLSFKNDLSEWNNSGVKNKENDNNGVLVPPRRRNLCINLFSKKDYKMKDENDFKED 559 
124507287  473 PLEKCPNEENKNVCTRFDKVYSCTSLSFKNDLSEWNNSGVKNKENDNNGVLVPPRRRNLCINLFSKKDYKMKDENDFKED 552 
86170351   563 LLNAAFSQGKLLGKKYSNYSNEAYEAMKFSYADYSDIVKGTDMMNDLKKLNKELNTLLKETEKGDISVDRKTWWDDNKNV 642 
124505649  560 LLNAAFSQGKLLGKKYSNYSNEAYEAMKFSYADYSDIVKGTDMMNDLKKLNKELNTLLKETEKGDISVDRKTWWDDNKNV 639 
124507287  553 LLNAAFSQGKLLGKKYSNYSNEAYEAMKFSYADYSDIVKGTDMMNDLKKLNKELNTLLKETEKGDISVDRKTWWDDNKNV 632 
86170351   643 VWNAMLCGYKTENENQQLNSSWCNVPDDDNIDQFLRWLTEWAQQYCKEKLIKAHIINTKCKDIVEGRKHKSMVDITDVEC 722 
124505649  640 VWNAMLCGYKTENENQQLNSSWCNVPDDDNIDQFLRWLTEWAQQYCKEKLIKAHIINTKCKDIVEGRKHKSMVDITDVEC 719 
124507287  633 VWNAMLCGYKTENENQQLNSSWCNVPDDDYIDQFLRWLTEWAQQYCKEKLIKAHIINTKCKDIVEGRKHKSMVDITDVEC 712 
86170351   723 KRLFIDYEEWFRYRYNQWKGLSEKYIKIKKSKNSGVNIPSEECAASYVTKHCNGCICNLRDMEDIHKNINNQNELMKEMI 802 
124505649  720 KRLFIDYEEWFRYRYNQWKGLSEKYIKIKKSKNSGVNIPSEECAASYVTKHCNGCICNLRDMEDIHKNINNQNELMKEMI 799 
124507287  713 KRLFIDYEEWFRYRYNQWKGLSEKYIKIKKSKNSGVNIPSEECAASYVTKHCNGCICNLRDMEDIHKNINNQNELMKEMI 792 
86170351   803 NIIKFDTDQYRTQLQNISNSMEINPKSVKTAVDTTKDIVSYGLAGTMGVAAIGLQAGDFLGKKIQDLYNEFMKPVEKKLD 882 
124505649  800 NIIKFDTDQYRTQLQNISNSMEINTKSVKTAVDTTKDIVSYGLAGTMGVAAIGLQAGDFLGKKIQDLYNEFMKPVEKKLD 879 
124507287  793 NIIKFDTDQYRTQLQNISNSMEINPKSVKTAVDTTKDIVSYGLAGTMGVAAIGLQAGDFLGKKIQDLYNEFMKPVEKKLD 872 
86170351   883 TSSKNLNIYEDPNIMVPAGIGVALTLGLLLFKMRRKAKRQVDMIRILQMSQNEYGIPTTKSPNKYVPYGSQRYKGKTYLY 962 
124505649  880 TSSKNLNIYEDPNIMVPAGIGVALTLGLLLFKMRTKPKHEVDMIRILQMSQNKYGIPTTKSPNKYIPYASQRYKGKTYIY 959 
124507287  873 TSSKNLNIYEDPNIMVPAGIGVALTLGLLLFKMRRKAKRQVDMIRILQMSQNEYGIPTTKSPNKYVPYGSQRYKGKTYLY 952 
86170351   963 VEGDT-DEEKYMFMSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTQNDIPSDNT--------PSYKL 1033
124505649  960 MEGDSgDEDKYIGNISSSDITSSESEYEEMDINDIYPYTSPKYKTLIEVVLEPSKSNGNTPSKGDGNtvgddmvpTTNTF 1039
124507287  953 VEGDT-DEEKYMFMSDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTQNDIPSDNT--------PSYKL 1023
86170351  1034 TDEEWNQLKDDFISQYLPNTEPN--NNYRSGNSPTNTNNTTTSHDNMGEKPFIMSIHDRNLYTGEEISYNINMSTNTNND 1111
124505649 1040 TDEEWSELKHDFISNMLQNQPNDvpNDYKSGDIPFNTQPNTLYFDNNQEKPFITSIHDRDLYTGEEISYNIHMSTNSMDD 1119
124507287 1024 TDEEWNQLKDDFISQYLPNTEPN--NNYRSGNSPTNTNNTTTSHDNMGEKPFIMSIHDRNLYTGEEISYNINMSTNTMDD 1101
86170351  1112 iPKYVSNNVYSGIDLINDTL-SGNKHIDIYDEVLKRKENELFGTNHVKQTSIHSVAKNTySDDAITNKINLFHKWLYRHR 1190
124505649 1120 -PKYVSNNVYSGIDLINDTL-SGNQHIDIYDEVLKRKENELFGTNHPKNTSNNSVAKLT-NSDPIMNQLDLLHKWLDRHR 1196
124507287 1102 -PKYVSNNVYSGIDLINDSLnSGNQPIDIYDEVLKRKENELFGTNHVKQTSIHSVAKNTySDDAITNKINLFHKWLDRHR 1180
86170351  1191 DMCEKWENHHERLAKLKEKWENDND-GGNVPSDNHVLNTDVSIEIDMDNPKPINQFSNMDInvdtpTMDNMEDDIYYDVN 1269
124505649 1197 DMCDKWNTKEDILNKLNEQWNKDNNvGGDIPNDNKMLNTDVSIQIDIDENKGKKDLSNMDT-----ILDDMEDDIYYDVN 1271
124507287 1181 DMCEKWENHHERLAKLKEKWENDND-GGNVPSGNHVLNTDVSIEIDMDNPKPINQFSNMDInvdtpTMDNMEDDIYYDVN 1259
86170351  1270 DNDDDNDQPSVYDIPMDHNKVDVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1325
124505649 1272 DNDDDNDQPSVYDISMDHNKVDVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1327
124507287 1260 DNDDDNDQPSVYDIPMDHNKVDVDVPKKVHIEMKILNNTSNGSLEQQFPISDVWNI 1315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap