Conserved Protein Domain Family
PTZ00153

?
PTZ00153: PTZ00153 
lipoamide dehydrogenase; Provisional
Statistics
?
PSSM-Id: 173442
View PSSM: PTZ00153
Aligned: 4 rows
Threshold Bit Score: 899.663
Threshold Setting Gi: 237842145
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
221053610   1 MGARAGTYMWIGWLLLLVTQNGIAKHTRGGHTLHSLHEKGSSVrggkirsNMFIRCNG---MRNGMRNGMRKGMRNGMRS 77 
124512464  11 VKLNVVTLIWLSYLFLLKPHGTLKNMMVCNAVLLPFNEKNKGI-------NNFVYINPkniILNKIKKDVIKLEKDNIIL 83 
156097959   1 --MGAGTVIWLGCLLLLVTQNGSAKRTGGGHALHLLHAKGDPApsgkrtsSAFIRCSS------SIGGGIGGDIGSNIVN 72 
237842145  28 AGETFGPCLRLTALLCILTTGVITLSAAFSVQRSAVVSQTFPVplsvstaSTQPHVAFvpsPASPFSLRASLQESPGVLT 107
221053610  78 GMSSSTRQTANQVEGCKSLRANG------SGKEQPMKPSIEQYDVGILGCGVGGHAAAINAMERGLKVIIFTGDKDSIGG 151
124512464  84 CQHNRKRDNYIKQQKRKEKNANNftfmlkGSTQNIMNINEKEYDLAIIGCGVGGHAAAINAMERNLKVIIFAGDENCIGG 163
156097959  73 SMDSSALTWGGRTSRGQSLRVRG------AAKGQAMSVSAEEYDVGILGCGVGGHAAAINAMERGLKVIIFTGDQDSIGG 146
237842145 108 PPPHYASLSSPQPRSEGVSRL--------FATSSSTNFSDEPFDVTIIGLGVGGHAAALHAAALGLKTAVVSGGDP--GG 177
221053610 152 TCVNVGCIPSKSLLYATGKYRELKNLAKLYTYGIYTNAFrKSGKEDPVERNQLLADTVQIDIGKLKEYTQSVINKLKGGI 231
124512464 164 TCVNVGCIPSKALLYATNKYRELKNLDKLYYYGIHSNIF-QNNKNTEIENNQLVSNSFQINITKLKEYTQSVIDKLRNGI 242
156097959 147 TCVNVGCIPSKSLLYATGKYRELKNLAKLYTYGIYTDAFgKNGKSDPVERNQMLADTVHLDIAKLKEYTQRVINKLKGGI 226
237842145 178 TCVNRGCVPSKALLAAARRVKMLRNKHHLSAMGLQ------------------VEGEIKVDPTGVGNHARGVVDKVRSGL 239
221053610 232 ENGLKKKKFCKNSEHVQVIYERGHIVEKNIIKGEKSGKEY-QVKNIIIATGSTPNIPDNIEVDEKTVFTSDQAVKLEGLQ 310
124512464 243 SHGFKTLKFNKNSEHVQVIYEHGQLLDKNTIKSKKSGNTY-KVKNIIIATGSVPNIPNNVEIDDKSVFTSDMAVKLVGLK 321
156097959 227 ENGLKNKKFCKNSEHVQVIYERGHIIDKNIIKGEKSGKEF-KVKNIVIATGSTPNIPDNIEVDGRTVFTSDEAVKLEGLQ 305
237842145 240 VSSLASHGIALFDARGVMDGEPGRVVLERTAGSPASLPPFlRTKNVILAPGSLPFIPAGTKEEQFSVMTSDTCVSLPWLP 319
221053610 311 KYMGIVGMGIIGIEFTDIYTALGSEVVSFDYSPQLLPLLDADVATYFERVFI---KSKPMRVHLNTCIEYVR--AGKGNQ 385
124512464 322 NYMSIIGMGIIGLEFADIYTALGSEITFLEYSSELLPIIDNDVAKYFERVFL---KNKPVNYHLNTEVKYIK--ASKNNN 396
156097959 306 NYMGIIGMGIIGIEFSDIYTALGSELISFDYSPQLLPLLDADVANYFERVFI---KSKPMRVHLNTRIEYVR--AGGGGQ 380
237842145 320 SEICIVGSGYIGLEFMDVFTSLGSEVVMVEAGPRLLPGVDKEVAKLAERLLLqqfKERPVKLYTNTLASQVRplGPKGEA 399
221053610 386 PVIIGHSERNdAEEDKPIQRNNKIKETRVDSCLVATGRKPNTNNMGLDDLQIQMNR-GFVSVDEHLRVER------KDQG 458
124512464 397 PVIIGYSHRT-GNDDNEKKNMTDVKELYVDSCLVATGRNPNTQNLGLEKLKIQMNR-GYVSVNDNLQVKM------ENNE 468
156097959 381 PVTIGHRERSeGEGDTPGYAANQIRETHVDSCLVATGRKPNTNNMGLEKLKIRTKR-GYVQVDEHLRVQR------EDQG 453
237842145 400 PVEVQLTDAQtKESKG---------KIYPDACLIATGRRPNTEGLGLDSLGVTLKRgGFIPVDACMRVLKhapegdEKPE 470
221053610 459 VYDNIFCIGDANGKQMLAHTASHQALKVVDWIISNGKETHNNTVHSiashndWASKPIIYRNIPSVCYTTPELAFVGLTE 538
124512464 469 IYDNIFCIGDANGKQMLAHTASYQALKVIDFIEKKEKKNVNINVEN------NLSKPILYKNIPSVCYTNPELAFIGLTE 542
156097959 454 VYNHIFCIGDANGRQMLAHTASHQALKVVDWIEAKGGEALKSDPSNgsh-sdWASKPIIYRNIPSVCYTTPELAFVGLTE 532
237842145 471 VIRGVYCVGDANGQMMLAHAASAQAVAAVETIAGR-------------------PRTVNVKHIPAACFTSPEIAFIGDTE 531
221053610 539 KEAKKLYpPE--NIGTEISFYKANSKVLCENNdITFPERSKNNSYNKGKYNTVDNTSGMVKIVYLKESKEILGLFIVGSY 616
124512464 543 KEAKVLY-PD--NVGVEISYYKSNSKILCENN-ISLNNNKKNNSYNKGQYNINDNTNGMVKIIYKEDTKEILGMFIVGNY 618
156097959 533 KEAKQLHpPE--NVGVETSFYKANSKVLCEHSdVSFPSLSKNNSYNRGKYNTVDHTTGMVKIVFLKDSKEILGMFIVGSY 610
237842145 532 EAAMELGaKDgfEVGKSVSHFRANTKAIAEGE-----------------------GEGILKVLYRKDTGKILGCHMIGIH 588
221053610 617 ASILIHEGVLALNLKLSVIDLAHMVHSHPTISEVLDTAFKAIAQVRTH 664
124512464 619 ASVLIHEAVLAINLKLSAFDLAYMVHSHPTVSEVLDTAFKSISKIRTH 666
156097959 611 ASILIHEGVLALNLKLSAVDLAHMVHSHPTISEVLDAAFKAIARVRTH 658
237842145 589 ASDLIQECATAITNDISVKDLAFTVHTHPTLSEVVDAAWKKAVGMNAH 636
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap