Conserved Protein Domain Family
PTZ00152

?
PTZ00152: PTZ00152 
cofilin/actin-depolymerizing factor 1-like protein; Provisional
Statistics
?
PSSM-Id: 173441
View PSSM: PTZ00152
Aligned: 4 rows
Threshold Bit Score: 202.49
Threshold Setting Gi: 237844535
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124505989   1 MISGIRVNDNCVTEFNNMKIRKTCGWIIFVIQNCEIIIHSKGASTTLTELVQSIDKNNEIQCAYVVFDAVSKIHFFMYAR 80 
156094344   1 MISGIRVNDTCITEFNNMKIRKTCRWIIFVIENCEIIIHSKGATTTLTELVESIDKNDKIQCAYVVFDAVNKIHFFMYAR 80 
237844535   1 MASGMGVDENCVARFNELKIRKTVKWIVFKIENTKIVVEKDGKGNA-DEFRGALPAND---CRFGVYDCGNKIQFVLWCP 76 
221057295   1 MISGIRVNDTCITEFNNMKIRKTCRWIIFVIENCEIIIHSKGDTTTLTELVKSIDQNDKIQCAYVVFDAVNKIHFFMYAR 80 
124505989  81 ESSNSRDRMTYASSKQAILKKIEGVNVLTSVIESAQDVADLK 122
156094344  81 ESSNSRDRMTYASSKQALLKKIEGVNVLTSVIESVQDVADFK 122
237844535  77 DNAPVKPRMTYASSKDALLKKLDGATAVALEAHEMGDLAALA 118
221057295  81 ESSNSRDRMTYASSKQALLKKIEGVNVLTSVIESAQDVADFK 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap