Conserved Protein Domain Family
PTZ00151

?
PTZ00151: PTZ00151 
translationally controlled tumor-like protein; Provisional
Statistics
?
PSSM-Id: 173440
View PSSM: PTZ00151
Aligned: 10 rows
Threshold Bit Score: 263.136
Threshold Setting Gi: 84999460
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156085986   1 MLVYKDLFTGDEVCSDAYTHLNPFDNPEFASVAFEVKSSKVAKGNEDYGIACNDDEeggGSSVAADPTVEMVIDIVDAFR 80 
71032323    1 MKVYKDLYSNDEVCSDAYDHHDPFDNADLSSVAFEVKTSKVPKGEEDYGIGYNDEEg--ADQMNVDPNVEMVVDVVDKFG 78 
66359174    1 MKVYKCIFTGDEVMSDSYKQTSPFGKAEFDDIAFEVQSKRVQKSAEDFGIAHNTEE---GEAEVVDADVETVNDIIDAFK 77 
124506139   1 MKVFKDVFTNDEVCSDSYVQQDPFEVPEFREIAFEVKSNKRIKGNEDYGIADNSED----AVEGMGADVEHVIDIVDSFQ 76 
84999460    1 MKVYRDLYSNDEVCSDAYDHLDPFDNPDLSSVAFEVKTSKVAKGEEDYGIGYNDEEg--GDQMNVDPNVEVVVDVVDKFA 78 
156095620   1 MKVYKDVFTNDEVCSDSYNQEDPFGIADFREIAFEVKSNKRIKGNDDYGIADNSEE----AVDGMGADVEQVIDIVDSFQ 76 
209880403   1 MKVYKCVFTGDEVISDSYKQLAPFGRDEFMDIAFEVESKRILKGSEDYGISHNTED---GEVEIGTTDAETVNDIIDAFK 77 
237836225   1 MKVYKDVFTGDELCSDSYAELPPMDDPSLSEVAFEVATKRIVKGAEDYGIADNSEE----DGGGVDSTSETVVDVVDAFR 76 
221057139   1 MKVYKDVFTNDEVCSDSYNQEDPFGIADFREIAFEVKSNKRIKGNDDYGIADNSEE----AVDGMGADVEQVIDIVDSFQ 76 
67624781    1 MKVYKCIFTGDEVMSDSYKQTSPFGKAEFDDIAFEVQSKRVQKSAEDFGIAHNTEE---GEAEVVDADVETVNDIIDAFK 77 
156085986  81 LQETPFTKAEYTGYIKKYIKRVTAHLEENAPDKVTSFKDDIQKFVKHVLGNFSDFEFYIGESLDLEAGLIYAYYNGEELA 160
71032323   79 LQSLSLTKKDYSSYIRKYIQRLVATLQEKNPERVEPFKTTVSDFVKHVLANFEDFEFYVGESLDYEAGLVYAYYKGEEVS 158
66359174   78 LESTPFTKKEYMTYIKAYLARIKEAMEKSNPDRVETFMKNAQTFVKYLLERFDDLEFYLGPSLDCEGIIIYGYYEDGDLA 157
124506139  77 LTSTAFSKKEYSAYIKNYMQKVAKYLEEKKPDRVEIFKTKAQPFIKHILTNFDDFEFYMGESLDMEAGIIYSYYKGEEIT 156
84999460   79 LQSLPLTKKDYSSYIKKYIQRLVATLQEKNPERVEPFKTSVSEFVKHVLANFDDFEFYVGESLDYEAGLVYGYYKGEEVS 158
156095620  77 LTSTSLSKKEYSVYIKNYMQKILKYLEEKKPNRVEVFKTKAQPLIKHILTNFDDFEFYMGESLDMDAGLTYSYYKGEEVT 156
209880403  78 LESTPFSKKEYMLYIKGYVSRLKGYLEQNNPDRVEKFMQNTQAFVKVLLERFNDLEFYLGPSLDCEGIIIYGYYNDGDLA 157
237836225  77 LQETPFSKKEFGTYIKGYMQRVKGHLEKNHPDRVDKFMSGAQALVKKILGQFDDFQFFLGESADCEAGVVFAYYKDGEEA 156
221057139  77 LTSTSLSKKEYSVYIKNYMQKILKYLEEKKPDRVDVFKTKAQPLIKHILTNFDDFEFYMGESLDMDAGLTYSYYKGEEVT 156
67624781   78 LESTPFTKKEYMTYIKAYLARIKETMEKSNPDRVETFMKNAQTFVKYLLERFDDLEFYLGPSLDCEGIIIYGYYEDGDLA 157
156085986 161 PRLVYIKEALTEERY 175
71032323  159 PRLVFLKDGLVEERY 173
66359174  158 PRFIYFKDALNEERY 172
124506139 157 PRFVYISDGLFEEKY 171
84999460  159 PRLVFLKDGLVEERY 173
156095620 157 PRFVYISDGLYEEKY 171
209880403 158 PRFIYFRDSLKEERY 172
237836225 157 PRLIYIRDGLKEEKY 171
221057139 157 PRFVYISDGLYEEKY 171
67624781  158 PRFIYFKDALNEERY 172
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap