Conserved Protein Domain Family
PTZ00137

?
PTZ00137: PTZ00137 
2-Cys peroxiredoxin; Provisional
Statistics
?
PSSM-Id: 173427
View PSSM: PTZ00137
Aligned: 3 rows
Threshold Bit Score: 475.591
Threshold Setting Gi: 156083230
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71032125    3 MKLTGISLITSFSYIRNSVPLKNTFTAFHTLNTRNGIKSAktpDRISSLKSVNGVRNYSSSEGLNNTVTSSLIGKLMPSF 82 
84999634    1 MKLTGISLISSLSYIRNTLPLKNTLTAFHTLNTRNNLKSV---NRITSVKSVNGVRNYSTSEGLCNTVTSSLVGKLMPSF 77 
156083230   1 -MMNGVLRLPTASAYRAMRMLSNKTTGWLNNDSVRCFRPV---------YNQFVVRAFGTQAGSCHTNIGDLVGREFPDF 70 
71032125   83 KGTALLGDDLVQFNSSDYFKDSYGLLVFYPLDFTFVCPSELLGFSERLKEFEERHVKVLGVSVDSPFSHKAWKELDVRQG 162
84999634   78 KGTALLSDDLVQFNSSDYFKDSYGLLVFYPLDFTFVCPSELLGFSERLKDFEERNVKVLGVSVDSPFSHKAWKELDVRQG 157
156083230  71 KTSAVINGNITEFDASAYFRDSYALLVFYPLDFTFVCPSELLGFSARLPEFEQRGIKVVGISIDSVFSHLAWLQMDLKKG 150
71032125  163 GVSPLKFPLFSDLSREVSSSFGLLRDEGFSHRASVLVDKAGVVKHVAMYELGLGRSVDETLRLFDAVQFAEKTGNVCPVN 242
84999634  158 GVSPLKFPLFSDMTREVSRSFGLLRDEGFSHRASVLVDKAGVVKHVALYDLGLGRSVDETLRLFDAVQFAEKTGNVCPVN 237
156083230 151 GVQGLKIPLVSDISRSISKSFGLLRSDGFAQRASVLIDKTGKVRHTAVFDLGIGRSVDETLRVFDAIKFNDESGQVCPVN 230
71032125  243 WKQGDQAMKPDSQSVKQYLSNRFN 266
84999634  238 WKQGDQAMKPDSQSVKQYLSNRFN 261
156083230 231 WQKGGAGMSQTSSSTGDYLFKTFS 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap