Conserved Protein Domain Family
PTZ00133

?
PTZ00133: PTZ00133 
ADP-ribosylation factor; Provisional
Statistics
?
PSSM-Id: 173423
View PSSM: PTZ00133
Aligned: 23 rows
Threshold Bit Score: 352.228
Threshold Setting Gi: 157873407
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66358980    7 MGLALTKIWRNLFGKKDMRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 86 
124802497   1 MGLYVSRLFNRLFQKKDVRILMVGLDAAGKTTILYKVKLGEVVTTIPTIGFNVETVEFRNISFTVWDVGGQDKIRPLWRH 80 
126644232   1 MGLALSRIWNRLFGKKEMRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 
146095530   1 MGGWLS----SLLGKKEVRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVETLEYKNLKFTMWDVGGQDKLRPLWRH 76 
157873520   1 MGGWLS----SLLGKKEVRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVETLEYKNLKFTMWDVGGQDKLRPLWRH 76 
156093405   1 MGLFVSRLFNRLFQKKDVRILMVGLDAAGKTTILYKVKLGEVVTTIPTIGFNVETVEFRNISFTVWDVGGQDKIRPLWRH 80 
209882857   1 MGLALSRIWNRLFGKREMRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 
209876175   1 MGLALTKIWRNLFGKKDMRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 
67607324    1 MGLALSRIWNRLFGKKEMRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 
67608009    1 MGLALTKIWRNLFGKKDMRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 
66358980   87 YYSNTDGLIFVIDSNDRERINDARDELARMLGEDELRDAVLLVFANKQDLPNAMSATDITEKLQLSGIRNRNWFIQSTCA 166
124802497  81 YYSNTDGLIFVVDSNDRERIDDAREELHRMINEEELKDAIILVFANKQDLPNAMSAAEVTEKLHLNTIRERNWFIQSTCA 160
126644232  81 YYTNTDGIIFVVDSNDRERINDSRDELMRMLGEDELRDATLLVLANKQDLPNAMSVTEVTEKLQLSSLRHRSWFIQSTCA 160
146095530  77 YYQNTNGIIFVVDSNDRDRMRDARAELDKMLVEDDLRAATLLVFANKQDLPNAMSTTEVTEKLGLHALRQRNWYIQGCCG 156
157873520  77 YYQNTNGIIFVVDSNDRDRMRDARAELEKMLVEDDLRAATLLVFANKQDLPNAMSTTEVTEKLGLHALRQRNWYIQGCCG 156
156093405  81 YYSNTDGLIFVVDSNDRERIDDAREELHRMINEEELKDAIILVFANKQDLPNAMSAAEVTEKLHLNTIRERNWFIQSTCA 160
209882857  81 YYTNTDGLIFVVDSNDRDRINDSRDELMRMLSEDELRDACLVVLANKQDLPNAMSVTEVTEKLQLSSIRHRNWYIQSTCA 160
209876175  81 YYSNTDGLIFVVDSNDRERINDARDELARMLSEDELRDAALLVFANKQDLPNAMSATDVTEKLQLSNIRNRHWYIQSTCA 160
67607324   81 YYTNTDGIIFVVDSNDRERINDSRDELMRMLGEDELRDATLLVLANKQDLPNAMSVTEVTEKLQLSSLRHRSWFIQSTCA 160
67608009   81 YYSNTDGLIFVIDSNDRERINDAKDELARMLGEDELRDAVLLVFANKQDLPNAMSATDITEKLQLSGIRNRNWFIQSTCA 160
66358980  167 TSGDGLYEGLDWLSRTLASRSN 188
124802497 161 TRGDGLYEGFDWLTTHLNNAK- 181
126644232 161 TAGDGLYEGLDWLARNLEKAAS 182
146095530 157 TTAQGLYEGLDWLSANIKKSMN 178
157873520 157 TTAQGLYEGLDWLSANIKKSMN 178
156093405 161 TRGDGLYEGFDWLTTHLNNSK- 181
209882857 161 TTGDGLYEGLDWLARNLEKIAS 182
209876175 161 TSGDGLYEGLDWLSRTLASKSS 182
67607324  161 TAGDGLYEGLDWLARNLEKAAS 182
67608009  161 TSGDGLYEGLDWLSRTLASRSN 182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap