Conserved Protein Domain Family
PTZ00124

?
PTZ00124: PTZ00124 
adenosine deaminase; Provisional
Statistics
?
PSSM-Id: 173415
View PSSM: PTZ00124
Aligned: 4 rows
Threshold Bit Score: 602.625
Threshold Setting Gi: 156082630
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156081963   1 MNILQEPIDFLKKEELkNIDLSQMSKKERYKIWKRIPKCELHCHLDLCFSADFFVSCIRKY-NLQPNLSDEEVLDYYLFA 79 
124802718   6 MDTSYEIINYLTKDEL-DIDLSCMDKKERYKIWKRLPKCELHCHLDVCFSVDFFLNVIRKY-NIQPNMSDEEIIDYYLFS 83 
156082630   1 ---MLKTMDVYPT----NAELQKMGEWERKSIWKKMPKMELHMHGDIACPVNKLIDIYNDYaDENDRLTEQDILQNIICN 73 
221054133   1 MNILQEPIDFLKKDELkNIDLSQMDKKERYKIWKRIPKCELHCHLDLCFSADFFLSCVRKY-NLQPNLSDEEVLDYYLFA 79 
156081963  80 KGGKSLGEFVEKAIKVADIF-HDYEVIEDLAKHAVFNKYKEGVVLMEFRYSPTFVAFKYNLDIELIHQAIVKGIKEVVEL 158
124802718  84 KPGKSLDEFVEKALRLTDIY-IDYTVVEDLAKHAVFNKYKEGVVLMEFRYSPSFMSFKHNLDKDLIHEAIVKGLNEAVAL 162
156082630  74 YKIKDLVEFIDKTRMICKVFaNNSKILERSSKEAILAKYREGVVGLEFRFSPAYLAEGCGYSYDEVVNDVLSGMEQAKKQ 153
221054133  80 KGGKSLGEFVEKAIRVADIF-QDYEMIEDLAKHAVFNKYKEGVVLMEFRYSPTFVAFKHNLDIELIHQAIVKGIKEVVEL 158
156081963 159 LDHKIHVALMCIGDTG-HEAANIKASADFCLKHKADFVGFDHGGHEVDLKEYKEIFDYVRESGVPLSVHAGEDVTLPNLN 237
124802718 163 LEYKIQVGLLCTGDGG-LSHERMKEAAEFCIKHKKDFVGYDHAGHEVDLKPFKDIFDNIREEGISLSVHAGEDVSIPNLN 241
156082630 154 IKTPFEVGAIYIGEIGiHDQFPFSESVDYFFKHRDKFIGFDNAGYPADFAPFADQFKRLVDAGVNLTLHAGE--TPPDCN 231
221054133 159 LDHKIDVTLLCIGDTG-HRAADIKASADFCLKHKADFVGFDHGGHEVDLKPYKEIFDYVKEGGMHLTVHAGEDVTLPNLN 237
156081963 238 TLYSAIQVLKVERIGHGIRVAESQELIDMVKEKNILLEVCPISNVLLKNAKSMDTHPIRQLYDAGVKVSVNSDDPGMFLT 317
124802718 242 SLYTAINLLHVKRIGHGIRVSESQELIDLVKEKDILLEVCPISNVLLNNVKSMDTHPIRMLYDAGVKVSVNSDDPGMFLT 321
156082630 232 ERLAMALDFGAKRIGHGIECAKSPEMMKRLIDEDVILEVCPKSNWITNPSINMSDHPIRKIYDAGVKVCINTDDPMMMTN 311
221054133 238 TLYSAIQVLKVERIGHGIRVSESQELIDMVKENNILLEVCPISNVLLKNAKSFDTHPIRKLYDAGVKVSVSSDDPGMFLT 317
156081963 318 NINDDYEELYTHLNFTLEDFMKMNEWALEKSFMDSNIKDKIKNLYF 363
124802718 322 NITDNYEELYTHLNFTLADFMKMNLWAVQKSFVDPDIKNKIISKYF 367
156082630 312 SLHEEYDLLFTHLGFGYADFVKMNTWALEKSFLSKEAKLTLKKAYF 357
221054133 318 NINDDYEKLYTHLHFTLEDFMKMNEWALEKSFIGCDIKEKIKKLYF 363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap