Conserved Protein Domain Family
PTZ00121

?
PTZ00121: PTZ00121 
MAEBL; Provisional
Statistics
?
PSSM-Id: 173412
View PSSM: PTZ00121
Aligned: 2 rows
Threshold Bit Score: 2547.77
Threshold Setting Gi: 124804929
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124804929    1 MGVLKHFFFLLFLYVNNTSAINNPQEEFMDRFDINKNHVNIKWSNSGIHGKGKFKYEIEERDVLS-EGNESEKSTICPNH 79  
221056678    1 MTLYSFLALVAFYCICKAKRIANPQEAFMDRFDIAKNHINIKWSTNGRLGEGDYKYDIDDGENTDfELSTESMTGTCPDN 80  
124804929   80 VKEGTYKLGCPDYGKTFLMGFEDNKYSEEFLNEISFGFLNKKYKLPIEIPLNKSGLSMYQGLFKRCPYNKKHYSMIKNEN 159 
221056678   81 GAQEMYKGSCPDYGKTFVMDLNVDEYNEEFLDEMSFGLLNKKLNLSIEIPVEKSGMAMYQGLFKRCPLDENHSSLIRKEH 160 
124804929  160 EYDMCFRKFYNNSNISTRIYKRGKQNrKYIYFSSHGLGGRLGANIEEPLHKYKNDEHYVTKKMRYPEKIKNLFDCSIYSH 239 
221056678  161 VYDMCFERIYNRMELTDRNKKRTLRN-NYLHFGWHGLGGRFGSNIDYPLHDYNPSESHVTRKMGFSGLIRNLSDCSIYSY 239 
124804929  240 CIGPCLYKDFNNSCFLNLPILFNHQTKECVIIGTHEEKRIHNCQSGSTdQNIQRCFLPVKKEKGNQWTYASSFIRTDYMT 319 
221056678  240 CMGPCFGKDFNNECFRSLPVVFNHRTKECVILGTHEASRRRNCLSQNS-YGFERCFVPMKKEAGKEWTYASSFLRPDYET 318 
124804929  320 KCPPRFPLNHTMFGYFNYSTGKCETYYMNHEKR-TLSFSKCIETLFNNIKKQDDVNNSSFLWGVWTIENNANEktnLASM 398 
221056678  319 KCPPRFPLNDTVFGYYNHRTGECKSAVKNNRGNyKSTFKNCIEGLFNHPEGDRGNGRNNFLWGVWFLEGSSEK---LSSM 395 
124804929  399 DNTGSCYFLKKKPTCVLKKENHFSFTILTANSFNLNQNIIYPELKNNSSKE-GSSLIHFKDPKQTNKRVLYENNKKSKRN 477 
221056678  396 NDIGMCSILREKPNCVLKKEKHYSFTNLTANSFDFAQSVTYPQVEEMHDQEnGVSNLGETAWEGREERIDLSEVDGKREE 475 
124804929  478 VRTKINSVNPFTIPSTLNTNEKEEYNKNevKNYPNNNISYIQKVHSSFVNNRFNiHSDSSFK----PIHKMIQMNIYTDN 553 
221056678  476 AGSEDKEIKETETYQNLQKNRKTEINEH--MGLSKENLNYMLPVQMRHESTHSN-RNDSIFRrkdePISQMLELNQPSKS 552 
124804929  554 KLYNNNNQKIKDSN------NNMNGMSVTQRSPSIGENQNGNPQQKYMERFDIPNNHIFIEWQKEGEYGNDEFKYNIISN 627 
221056678  553 YLHNLGARGWGRYNishwnsRRINNGSVSQNEGNMSSKLSKNPQSKFMERFDIPKNHIFINWKKDGEFGEGNLKYDILSN 632 
124804929  628 KTAGTSQSLFHNYKDKTCPNHVYEGRAHGSCPNYGKAIIVQNLLGEEYDKNFNLNFLNEIRTGYLNKYFKKDVEISYENS 707 
221056678  633 KTAGTAQSLLIDNYNDVCPNHSIPGRAQGSCPNYGKAIIVERPENKNEDSNFNYESLNEIHTGYLGRISINVVELPYDKS 712 
124804929  708 GIAMHNNMLRSCPVHENEEKLFSVKTDYNYKMCKSKIFSNRFTMKEYDPKTRLFMYYGLYGLGGRLGANI---KRDKQKE 784 
221056678  713 GIAMHHGFPASCPIDKQEERLLQRMNDYNYDMCKSRVFPSPLSMKELDYRNRTLKYYGLYGFGGRLGSTIsinSRNVGRG 792 
124804929  785 KKYEDNITLPMKNPSLIKNLFDCSIYSYCLGPCLENSFGNKCFRNLPAYYNHLTNECVILGTHEQERTNSCRRTKEEKKK 864 
221056678  793 EKRTNNITLPMKNPGLINNLLDCSIYSYCLGPCMEGTYRNKCFRNLPAYYNHATNECVILGTHEQERNSNCRKETSDLSR 872 
124804929  865 PNCQILRKTTDSKDWTYVSSFIRPDYETKCPPRYPLKSKVFGTFDQKTGKCKSLMDKAYEVGINKFSVCLEYLFLVSPKD 944 
221056678  873 PNCQKIRKTLDSKDWTYVTSFIRPDYEEKCPPRFPLNSKSFGIYDERTGKCRSLIGEDNYVGIQNFGGCLEYLFINSPKD 952 
124804929  945 LYNSGRNNYWGIWAADHSVNENNIEIANGKCYHLVVKPTCVIDKENHFSFTALTANTVDFNQSVNIRKIEELTEygnndd 1024
221056678  953 LYNSDRKKYWGVWIGKEPVNDYNMFRVTGECYHILQKPTCVIHKENHFSFTSLTTNYIDFYQNFNIEPVEELVE------ 1026
124804929 1025 vlkEKEINNEPIDNVNETKINRKSHVNSMERNKPSykENEYDQMEKNVEDETYSEEFGLFEEARKtetgRIEEESKKKEA 1104
221056678 1027 ---RRDIIDLDKEGNHYGRAEARAQVGQDRGLNPS--DFDFTAKKDSRATEATEEAKKKAEEAKK----KAEEARKAEEA 1097
124804929 1105 MKRAEDARRIEEARRAEDARRIEEARRAEDARrveiaRRVEDARRIEISRRAEDAKRIEAARRAIEVRRA-ELRKAEDAR 1183
221056678 1098 KKKAEEVRKAEEVRKAEEVRKAEEARKAEEDK-----RKAEEARKAEEARKAEEARKAEEARKAEEVRKAeEVRKAEEVR 1172
124804929 1184 RIEAARRYENERRIEEARRYEDEKRIEAVKRAEEVRKDEEEAKRAEKERnneeirkfeearmahfarrqaaiKAEEKRKA 1263
221056678 1173 KAEEARKAEEVRKAEEVRKAEEARKAEEVRKVEEAKKKAEEARKAEEVR-----------------------KAEEARKA 1229
124804929 1264 DELKKAEEKKKADELKKSEEKKKADELKKKAEEKKKADELKKKAEE-KKKADELKKKAEEKKKADEVKKAEEKKKADELK 1342
221056678 1230 EEVRKAEEVRKAEEARKAEEVRKVEEAKKKAEEARKAEEAKKKAEEaKKKAEAAKKKAEEAKKKAEAAKKKAEAAKKKAE 1309
124804929 1343 KSEEKKKADELKKSEEKKKADELKKKAEEKKKADELKKKAEE-KKKADELKKKAEEKKKADELKKKAEEKKKADELKKKA 1421
221056678 1310 AAKKKAEAAKKKTEEAKKKAEAAKKKAEEVRKAEEAKKKAEEdKKKAEEVKKAEAAKKKAEEAKKKAEEVRKAEEAKKKA 1389
124804929 1422 EEKKKADELKKKAEEKKKAENL-KKAEEKKKADELKKKAEEKKKADELKKKAEE-KKKADELKKKAEEKKKADELKKAEE 1499
221056678 1390 EEARKAEEAKKKAEEARKAEEAkKKAEEARKAEEAKKKAEEARKAEEAKKKAEEaKKKAEEARKAEEAKKKAEEARKAEE 1469
124804929 1500 KKKADELKKAEEKKKADELKKAEEKKKADELKKAEELKKAEEKKKVEQKKREEERRnmalRRAEILKQIEKKRieevmkl 1579
221056678 1470 ARKAEEARKAEEARKAEEARKAEEVRKAEEVRKAEEVRKAEEVRKAEEARKAEEDK----RKAEEARKAEEAR------- 1538
124804929 1580 yeeekkmKAEQLKKEEEEKiKAEQLKKEEEEKKkveqlkkkeEEEKKKAEQLKKEEEenkIKAEQLKKKEEEEKKKAEEL 1659
221056678 1539 -------KAEEARKAEEAR-KAEEVRKAEEVRK---------AEEVRKAEEVRKAEE---VRKAEEARKAEEDKRKAEEA 1598
124804929 1660 KKEEEEEKKKAEQlkKEEEEKKKVEQLKKkeEEEKKKAEQLKKEEEENkiKVEQLKKEEEEEKKKAEELKKEEEEKKKVQ 1739
221056678 1599 RKAEEDKRKAEEA--RKAEEARKAEEVRK--AEEVRKAEEVRKAEEVR--KAEEAKRKAEEDKRKAEEARVDEGEKNKIA 1672
124804929 1740 QlkkeeekkaeeirkekeaVIEEELKKEDekrrmevEKKIKDTKDNFENIQEGNNKNTPYIN--KEMFDSEIKEVVITKN 1817
221056678 1673 H------------------VIKEGVDEKD-------DRTTKDIFSNSAVIIEGGKEGNLVVNdsKETEVSATKEVADSSN 1727
124804929 1818 MQLNEADAFEKH----NSENSKSSNKNADFSKEKDLLEDDIENILETDENEKINKDDIER--SNNNMKGNNNDIIYTKLD 1891
221056678 1728 SVREESKEVQQHkfnkNNISGEDGNSESNSNSETYNKEDFEEEVEEAKMIKQLDNNDMESeiPNSNYAPKNYESTDDKLD 1807
124804929 1892 VEEYKKRDVNETREKIIKISKKNMCNNDFSSKYCDYMKDNISSGTCSNEERKSLCCSISDFCLKYFDHNSNKYYDCTKIE 1971
221056678 1808 KDEYIKRNAEKTRQEIINLSKKDPCIVDVSSKFCDYMKENISSGNCSDVERKELCCSISNYCLKYFSYSSNEYYNCMNEE 1887
124804929 1972 FADPLYRCFKKKEFSNMVYFAGAGIVLILLFVIGSKMIIGKWFEEATFDEMDLNYDKIYTLAMINNEETQVSNPLSYSEE 2051
221056678 1888 FGHKDYKCFQKSKVSNTAYFAGAGIVLILLLVIVSKAILGKWFNEATFDEFDENYEKVYTLAMINREQIQEAGSLDFSGY 1967
124804929 2052 NIIK 2055
221056678 1968 MSDK 1971
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap