Conserved Protein Domain Family
PTZ00117

?
PTZ00117: PTZ00117 
malate dehydrogenase; Provisional
Statistics
?
PSSM-Id: 173409
View PSSM: PTZ00117
Aligned: 9 rows
Threshold Bit Score: 476.521
Threshold Setting Gi: 237837615
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156099230   2 TSVKHPKISVLGAGDIGCTLAHMICEKNLGDVVLHDFRKDLPKGRALDILHTRPLNRSRINILGTNEIT-DIKDSLVVVV 80 
66362542   10 TVIMRKKISIIGAGQIGSTIALLLGQKDLGDVYMFDIIEGVPQGKALDLNHCMALIGSPAKIFGENNYE-YLQNSDVVII 88 
86171227    1 ----MTKIALIGSGQIGAIVGELCLLENLGDLILYDVVPGIPQGKALDLKHFSTILGVNRNILGTNQIE-DIKDADIIVI 75 
156101009   1 ----MPKISMVGSGQIGAIVGQLILMENIGDIVLYDVMQGVPQGKSLDLKHFSTIVGVNKNILGTNNVQ-DIKDSDVIVI 75 
209881255   1 MTTNKKKISIIGAGQIGSTIALLLGQKNLGDIFLFDIIEGMPQGKALDLIHCMSVINSPTYITGTNEYS-DLQDSDVVII 79 
237837615   5 LVQRRKKVAMIGSGMIGGTMGYLCALRELADVVLYDVVKGMPEGKALDLSHVTSVVDTNVSVRAEYSYEaALTGADCVIV 84 
221058887   2 TSVKHPKISVLGAGDIGCTLAHMICEKNLGDVVLHDFTKDLPKGRALDILHTRPLNRSRINILGTNEIT-DIKDSLVVVV 80 
221057966   1 ----MTKISMIGSGQIGTIVGQLILMENIGDIVLYDVMQGVPQGKSLDLKHFSTIVGVNKKIVGTNNVE-DIKDSDVIVI 75 
67604985    1 ---MRKKISIIGAGQIGSTIALLLGQKDLGDVYMFDIIEGVPQGKALDLNHCMALIGSPAKIFGENNYE-HLQNSDVVII 76 
156099230  81 TIEVSEREfaefdeEDIERQVYTSNVKLLKEVSKSIKKHCPQAFVVVTTNPVDCMAKVLQENANIPSHKICGMAGVLHSA 160
66362542   89 TAGVPRKP------NMTRSDLLTVNAKIVGSVAENVGKYCPNAFVICITNPLDAMVYYFKEKSGIPANKVCGMSGVLDSA 162
86171227   76 TAGVQRKE------GMTREDLIGVNGKIMKSVAESVKLHCSKAFVICVSNPLDIMVNVFHKFSNLPHEKICGMAGILDTS 149
156101009  76 TAGVQRKE------GMTREDLIGINGKIMKSVAESVKVHSPNAFVICVSNPLDIMVNVFQKYSGLPHEQICGMAGILDTS 149
209881255  80 TAGVPRKP------NMTRSDLLSINAKIISSVAENIKEFCPNSFVICITNPLDAMVYYFKEKSGFASNMVCGMAGVLDSS 153
237837615  85 TAGLTKVPgkp-dsEWSRNDLLPFNSKIIREIGQNIKKYCPKTFIIVVTNPLDCMVKVMCEASGVPTNMICGMACMLDSG 163
221058887  81 TIEVSEREfaefdeEDIERQVYTSNVKLLKEVSKSIKKHCPQAFVVVTTNPVDCMAKVLQVHGNIPSHKICGMAGVLHSA 160
221057966  76 TAGVQRKE------GMTREDLIGINGKIMKSVAESVKLYSPNAFVICVSNPLDIMVNVFHKYSGLPYEKICGMAGILDTS 149
67604985   77 TAGVPRKP------NMTRSDLLTVNAKIVGSVAENVGKYCPNAFVICITNPLDAMVYYFKEKSGIPANKVCGMSGVLDSA 150
156099230 161 RLRHNLAEKLRVNPGDVQGFVIGAHGDKMVPLPRYCCVNGIPLHDFTKKGAITEKEISQIVEKTRNTGLELLELLPEGSV 240
66362542  163 RFRCNLSRALGVKPSDVSAIVVGGHGDEMIPLTSSVTIGGILLSDFVEQGKITHSQINEIIKKTAFGGGEIVELLKTGSA 242
86171227  150 RYCSLIADKLKVSAEDVNAVILGGHGDLMVPLQRYTSVNGVPLSEFVKKNMISQNEIQEIIQKTRNMGAEIIK-LAKASA 228
156101009 150 RFRTLLAEKLKVAPQNVSQVLLGGHGDLMVPLERYCSISGIPLSEFVKKNLISKEEINEIVKQTRDMGSQIIK-LAKSSA 228
209881255 154 RFKCHLSQKLGVRPNDISAIVIGGHGDRMIPMRSSITVGGLALSNFIRDGQITNDELDAIIKRTAFAGGEILDLLKTSSA 233
237837615 164 RFRRYVADALSVSPRDVQATVIGTHGDCMVPLVRYITVNGYPIQKFIKDGVVTEKQLEEIAEHTKVSGGEIVRFLGQGSA 243
221058887 161 RLRHNLAEKLRVNPGDVQGFVIGAHGDKMVPLPRYCCVNGIPLHDFTKKGAITEKEISQIVEKTRNTGLELLDLLPEGSV 240
221057966 150 RFRSLLGEKLNVAPENVNLVLLGGHGDLMVPLKRYCSVSGIPLSDFIEKKLITNEEINDIIKKTRDMGAEIIK-LSKSSA 228
67604985  151 RFRCNLSRALGVKPSDVSAIVVGGHGDEMIPLTSSVTIGGILLSDFVEQGKITHSQIDEIIKKTAFGGGEIVELLKTGSA 230
156099230 241 CFAPSLAIVEIIEAYLKDLKRVLVCSVPLNGQYGHKGVFAGIPVVIGGKGIEKIIELDLNAQEKELFDDSLKHISYLFEN 320
66362542  243 FYAPAASAVAMAQAYLKDSKSVLVCSTYLTGQYNVNNLFVGVPVVIGKNGIEDVVIVNLSDDEKSLFSKSVESIQNLVQD 322
86171227  229 AFAPAAAITKMIKSYLYNENNLFTCAVYLNGHYNCSNLFVGSTAKINNKGAHP-VEFPLTKEEQDLYTESIASVQSNTQK 307
156101009 229 TFAPAAAIVKMIKSFLFNESQLYTCAVYLNGLYNCSDLYVGTTAIINSSGAKP-IEFALTQEEQQLYDKSIAFVREHTQK 307
209881255 234 FFAPAASAVAMVEAYIKDSKALLVCSAEPNGEYGVKGLFVGVPVIIGSRGVEKVVEVEMSGSEEQLFKDSIESIKELLET 313
237837615 244 YYAPAASAVAMATSFLNDEKRVIPCSVYCNGEYGLKDMFIGLPAVIGGAGIERVIELELNEEEKKQFQKSVDDVMALNKA 323
221058887 241 CFAPSLAIVEIIEAYLKDLKRVLVCSVPLNGQYGHKGVFAGVPVVIGGKGIEKIIELDLNAQEKELFDDSLKHISYLFEN 320
221057966 229 TFSPAAAIVKMIKSYLYNESQLYTCAVYLNGLYNCSNLYVGSTAIINSSGAKA-IEFALTKEEQELYDKSISFVHEHTQK 307
67604985  231 FYAPAASAVAMAQAYLKDSKSVLVCSTYLTGQYNVNNLFVGVPVVIGKNGVEDVVIVNLSDDEKSLFSKSVESIQNLVQD 310
156099230 321 YKHEAV 326
66362542  323 LKSLNL 328
86171227  308 AFDLIK 313
156101009 308 AFALIN 313
209881255 314 MKSLNL 319
237837615 324 VAALQA 329
221058887 321 YKHEAV 326
221057966 308 AFALIN 313
67604985  311 LKSLNI 316
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap