Conserved Protein Domain Family
PTZ00116

?
PTZ00116: PTZ00116 
signal peptidase; Provisional
Statistics
?
PSSM-Id: 173408
View PSSM: PTZ00116
Aligned: 3 rows
Threshold Bit Score: 313.14
Threshold Setting Gi: 156097100
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124506641   1 MDSFLNRLNVLFYSMALCFLILCAFNYGTSFYLFDEKEIKTNIQVKSIKRFVYNRYINADEAVLSLDVSYDMRKAFNWNL 80 
156097100   1 MDNVLNRLNVLSYSMALCFFTLCLFNYGTSFYLFDEKEMSTSIKVKSVKRLVYNRHIKGDEAVLSLDLSYDMSKAFNWNL 80 
221054352   1 MDNVLNRLNVISYSMALCFLILCLFNYGTSFYLFDEKAMSTNIKVKSVKRLVYNRHIKGDEAVLSLDLSYDMSKAFNWNL 80 
124506641  81 KQLFVYVLVTYETPKKIKNEVIIQDYIVKNKKQAKKNYRNFITKYSLKDYYNGLRNNLIHLQVCYKYMPIVGFSRSFEGA 160
156097100  81 KQLFLYVLVTYETPEKVKNEVIIQDYIITNKKMAKKTHKNFFTKYSLKDYNNGLRNNNINLQVCYKYMPIVGLSRSYEGA 160
221054352  81 KQLFLYVLVTYETPEKVKNEVIIQDYIITNKNVAKRTYKNFITKYSLKDYNNGLRNNNINLQVCYKYMPIVGLSRSYEGT 160
124506641 161 KISYQLPPEYFDNLPSNYPLYYPDK 185
156097100 161 KISYKLPAEYFDNLSANYPLYYPDK 185
221054352 161 KISYKLPAEYFDNLPSNYPLYYPDK 185
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap