Conserved Protein Domain Family
PTZ00111

?
PTZ00111: PTZ00111 
DNA replication licensing factor MCM4; Provisional
Statistics
?
PSSM-Id: 173403
View PSSM: PTZ00111
Aligned: 3 rows
Threshold Bit Score: 1370.07
Threshold Setting Gi: 221060995
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
84996055    1 MDFTPRSR-------------------------QVLSGRVDSLRPD-------SQVFNPNNTRDLSNNETQYTMYGKTPN 48  
71028098    1 MDFTPRSR-------------------------QVLSGRVDSLRPD-------SQVFNPNNTRDVSNNETQYTMYGKTPN 48  
221060995   1 -MGTPRRRpgqnaspyamsssnifgtnneifgsNFMNSPVSSRRTKnskgsflNSMMNESKYLNESNAGSQFMRYGHTPL 79  
84996055   49 LVRRIRNARNDIGDLGRETFMDQRDVARLPFLLDNRLEELSERFTNFLKNF--TEFEAPVESKDEQQNKPATTEL----- 121 
71028098   49 LVRRIRNARNDIGDLGRETFMDQRDVARLPFLLDNRLEELSERFTNFLKNF--TEFDTNSEDKDKQQSKPSNTEL----- 121 
221060995  80 AIRRIKCARADIGDVGREAFMEDVESGRLPHFIDSNLEQIKELFNQFFDEFniTNYSDVLQFTDEDRSITEYILLhrdnl 159 
84996055  122 -----YYLVKLMNFI--------------KENLRDHSTGYSRFLPFEVDLMHVYSFDLVLYKLLVTFPADCIAELDKVLV 182 
71028098  122 -----YYLMKLMNFI--------------KENLRDHSTGYSRYLPFEVDLMHVYSYDMVLYKLLVTFPADCIAELDKVLV 182 
221060995 160 kvylaYYGWKMIKFIetgrqnecklnnemEETDSDAVKNLEHIKSFEVDLTHIYFFNKKLYKLIIEYPSDCISEIDKIIS 239 
84996055  183 KLFNELL------------SKHYSDLSLENNSFFPRARLMNKPVSDCVGNLEPSMADSLVQFSGTVVRQTWIVPEITMAC 250 
71028098  183 KLFNELL------------SKHYSDLSLENNSFFPRARLMNKPVSDCVGNLEPSMADSLVQFSGTVVRQTWIVPEITMAC 250 
221060995 240 AKYNSLLalvldgdtksnaSDRYSLTNAKQD--YCRVRFFNKKHKDTPRKLGPNHIETLVCIKGVIIRCSNIIPEMTMAA 317 
84996055  251 FRCRGQKKLGLNDIQPCTCEHYEYVIQGEVNEPLLCNECHSKYTFELNHNMCVYSTKKIVKLLQSNSSTNNPDKDGLDNS 330 
71028098  251 FRCRGQKKVGLNDMQPCTCEHYEYVIQGEVNEPLLCNECNSKYTFELNHNMSVYSTKKIVKLLQSNSSPNNPDKDGLDDS 330 
221060995 318 FKCTSKKRIGVNNYEKCNEEVYEHVIQGEVQEPLTCTNCNNKNTFELWHNNCCFSSKQLIKLSEVTEHLKQGETP----- 392 
84996055  331 VdDNSGLNGEIYMKDNEVINLNLYDDLIDSVITGDRVTVVGILKVTPIRTSTTRRTLKSLYTYFVNVIHVK--------- 401 
71028098  331 V-DNADLNGEIYMKDNEVVNLNLYDDLIDSVVTGDRVTVVGILKVTPIRTSTTRRTLKSLYTYFVNVIHVK--------- 400 
221060995 393 ----------------QSISIYAYDDLIDYTKPGDTVELTGILKASPVRLNPRSRCYNSVHRTYINVIHIRkenkqkmkl 456 
84996055  402 ---------VINSTNANQPTKGLKYLGNEND--FSDLQVYRILELSRNPMIYRILLDSFAPSIKARNNVKIGLLCQLFSS 470 
71028098  401 ---------VINSTNANQPMKGLKYLGNEND--FSDLQVYKILELSRNPMIYRILLDSFAPSIKARNNVKIGLLCQLFSC 469 
221060995 457 teqndtasvILKRNDDGTVEENFEKLNEQGNllFTTEVIQKMQKLSTDPNIYQRLVDSLAPSIYGRDDIKKGLLCQLFGG 536 
84996055  471 NANSSDTNKSPDACYKVDNFRGIINVLLCGDPGTAKSQLLHYTHLLSPRSIYTSGKSSSSVGLTASIKFNESDNGRAMIQ 550 
71028098  470 NPNSSDNNKTVDSSYKVDNFRGIINVLLCGDPGTAKSQLLHYTHLLSPRSIYTSGKSSSSVGLTASIKFNESDNGRAMIQ 549 
221060995 537 SKTTDKFK---------NKYRSEIHILLCGDPSTAKSQLLHYVHKLSPRGIYTSGKGSSSVGLTAFIS-KDSETKEYILE 606 
84996055  551 PGAVVLANGGVCCIDELDKCHNESRLSLYEVMEQQTVTIAKAGIVATLKAETAILASCNPINSRYNKNKAVIENINISPS 630 
71028098  550 PGAVVLANGGVCCIDELDKCHNESRLSLYEVMEQQTVTIAKAGIVATLKAETAILASCNPINSRYNKNKAVIENINISPS 629 
221060995 607 SGAVVLSDKGICCIDEFDKMDDSARAILHEVMEQQTVTIAKAGIVATLNARTSVLASANPINSRYDKNKAVVENINLPPS 686 
84996055  631 LFTRFDLIYLVLDHIDQDTDQLISLSIARDFL----------------------------LPHMTGASDSFDTYDRSNTM 682 
71028098  630 LFTRFDLIYLVLDHIDQDTDQLISLSIAKDFL----------------------------LPHMTGVNSASDTYDRSNTM 681 
221060995 687 LFSRFDLIYLVIDQANEEEDKKLATVLCKNFSygmedgsdtdtddesnseenseygdefnVPSQFDSGNDEDPYQRRKRN 766 
84996055  683 HVESEMLRSEKDYNMN------DLDMMRMYIKFSKLHCFPKLSDEAKKVITREYVKMRQGNFQTSNLDELEHAQEDDDDD 756 
71028098  682 HVEPEILRSEKDYNLN------DLDMLRMYIKFSKLHCFPKLSDEARKVITREYVKMRQGNFQTSNLDELDQAQEDEDDD 755 
221060995 767 IREDQSVNPNKSYKKNskkyliDSNTLALYIAYCRITCNPIISLESKKIIIDEYIKMR---------------------- 824 
84996055  757 LYYQSSGTRMIYVSSRMISSIIRIAVSLARMRLSTLVTKADALQAVQIVKSSTFQSLVDPTTGKIDFDQLHQGITTNKMQ 836 
71028098  756 LYYQSSGTRMIYVSSRMISSIIRIGVSLARMRLSTFVTRADALQAVQIVKSSTFQSLVDPTTGKIDFDQLHQGITTNKMQ 835 
221060995 825 ---CKEGSKSPTASPRQLEGLVRLSQSLARMKLKDVVTPEEANEAVRLMNIATFQSLIDPLSGRIDFDQVNLGQTSQHKK 901 
84996055  837 QLNQMYEQVLSVLTRSSNQDSNKSLDLNEVLNLLNKDFKDVYDHKDGEIYKLISDVLNKMVQEGTAVRENNSYRLKKIFS 916 
71028098  836 QLNQMYEQVLSVLTRSSNQDSNKSLDLNEVLSLMSKEFKDAHDHKDGEIYKLISEVLNKMVQEGTAVRENNSYKLKKIFS 915 
221060995 902 KSDQIKDIIMNALVL-------RNMTKDELLSHCHETIMNNRDYSMAMDRKSFEEAFHDLERSQEITRLCSGLYKKK--- 971 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap