Conserved Protein Domain Family
PTZ00098

?
PTZ00098: PTZ00098 
phosphoethanolamine N-methyltransferase; Provisional
Statistics
?
PSSM-Id: 173391
View PSSM: PTZ00098
Aligned: 3 rows
Threshold Bit Score: 490.252
Threshold Setting Gi: 124513590
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124513590   4 IENLNSDKTFLENNQYTDEGVKVYEFIFGENYISSGGLEATKKILSDIELNENSKVLDIGSGLGGGCMYINEKYGAHTHG 83 
156096348   1 MISEPVDIKYLENNQYSDEGIKAYEFIFGEDYISSGGIIATTKILSDIQLDANSKVLDIGSGLGGGCKYINEKYGAHVHG 80 
221058559   1 MVSESVDIEYLENNQYSDEGIKAYEFIFGEDYISSGGIVATTKILSDIYLEPNSKVLDIGSGLGGGCKYINEKYDAHVYG 80 
124513590  84 IDICSNIVNMANERVSGNNKIIFEANDILTKEFPENNFDLIYSRDAILHLSLENKNKLFQKCYKWLKPTGTLLITDYCAT 163
156096348  81 VDICEKMVTIAKLRNQDKAKIEFEAKDILKKDFPESTFDMIYSRDSILHLSYADKKMLFEKCYKWLKPNGILLITDYCAD 160
221058559  81 VDICEKMIAIAKLRNKDKSKVEFEAMDILKKDFPECTFDMIYSRDAILHLPYADKKKLFEKCYKWLKPNGILLITDYCAD 160
124513590 164 EKENWDDEFKEYVKQRKYTLITVEEYADILTACNFKNVVSKDLSDYWNQLLEVEHKYLHENKEEFLKLFSEKKFISLDDG 243
156096348 161 KIENWDEEFKAYIKKRKYTLMPIQEYGDLIKSCKFQNVEAKDISDYWLELLQLELSKLEEKKEEFLKVYSIKEYNSLKDG 240
221058559 161 KIENWDEEFKAYINKRKYTLIPIQDYGDLIKSCNFQNVQAKDISDYWLELLQMELNKLEEKKDEFLKLYPTDEYNSLKDG 240
124513590 244 WSRKIKDSKRKMQRWGYFKATKN 266
156096348 241 WTRKIKDTKRDLQKWGYFKAQKM 263
221058559 241 WTRKIKDTKRHLQKWGYFKAQKM 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap