Conserved Protein Domain Family
PTZ00095

?
PTZ00095: PTZ00095 
40S ribosomal protein S19; Provisional
Statistics
?
PSSM-Id: 140127
View PSSM: PTZ00095
Aligned: 15 rows
Threshold Bit Score: 262.79
Threshold Setting Gi: 72387824
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71026324    1 METSVDLRKYKLKKADRvvpyrRLNTSLKDCNPDLFVKAFAEHMKLKGYLECPKRLDYAKTSVAKELAPQDPDWFYIRAA 80 
124505571   2 AEQFTEDIGVVNKRLLEpvpfvKTNNCIKDVDADLFIRSYATHLKLHNKITYPKWCTFVKTGKGRKLAPLNEDWYFIRAS 81 
85001381    1 METSVDLRKYKLKKADRvvpyrRLNTSLKDCNPDLFINAFAEHMKLKGYLECPKRLDYAKTSVAKELAPQNPDWFYVRAA 80 
73537065    1 ----MTAPRNKIHRIGK-----RKGATLKDVSAWRWIKTAARHFKQEGKIFVPNCTEIMKSSHGRERAPQNPDWYYIRCA 71 
154336559   1 ----MAALKNKIRRIGK-----RKGATLKDVSAWRWIKTAARHFKQEGKIFVPNCTELIKSSHGRERAPQNPDWYYVRCA 71 
146093379   1 ----MTAPRNKIHRIGK-----RKGATLKDVSAWRWIKTAARHFKQEGKIFVPNCTEIMKSSHGRERAPQNPDWYYIRCA 71 
146099358  16 PSCIMAALKNKIHRIGK-----RKGATLKDVSAWRWIKTAARHFKQEGKIFVPNCTEIMKSSHGRERAPQNPDWYYIRCA 90 
154331729  65 SYPSMAALKNKIRRIGK-----RKGATLKDVSAWRWIKTAARHFKQEGKIFVPNCTELIKSSHGRERAPQNPDWYYVRCA 139
157876035   9 PSCIMAALKNKIHRIGK-----RKGATLKDVSAWRWIKTAARHFKQEGKIFVPNCTEIMKSSHGRERAPQNPDWYYIRCA 83 
156087679   1 MELSLDKQMRRLGHYDAevpyrRFNTSLNDCQPDVFIAAFAQQMELKNYIDPPKWIDYVKTSCAKELAPQDPKWFYIRSA 80 
71026324   81 AVLRHLYFHPDSGVDRLRKVYSSKKRNGSAPNHTCRASGKILRTIVQQLESIGFLEQDlKKHGRRLSRKGCNTVNAFARQ 160
124505571  82 SILRRLYLHPDIGVGFLRRQFSSKQRRGVAPNHTSLASGKILRSILQQLENLGYVEQNpKKKGRRLTTKGENAINNFARY 161
85001381   81 AVLRHLYFHPDSGVDRLRKAYSSKKRNGSAPNHTCRASGKILRTIVQQLESIGFLEQDlKKRGRRLSRKGCNTVNAFARQ 160
73537065   72 AVLRAIYLRPGVGYGGLSKRFGNKKNYGSRPEHTVTSSTGPLHWACKSLTKLGLVEPG-AQSGQRLTRKGHKFADSLAFQ 150
154336559  72 AVLRAIYLRPGVGYGGLSKRFGNKKNYGSRPEHTVNSSTGPLHWACKSLTKLGLVEPG-AQSGQRLTRKGHKFADSLAFQ 150
146093379  72 AVLRAIYLRPGVGYGGLSKRFGNKKNYGSRPEHTVTSSTGPLHWACKSLTKLGLVEPG-AQAGQRLTRKGHKFADSLAFQ 150
146099358  91 AVLRAIYLRPGVGYGGLSKRFGNKKNYGSRPEHTVTSSTGPLHWACKSLTKLGLVEPG-AQSGQRLTRKGHKFADSLAFQ 169
154331729 140 AVLRAIYLRPGVGYGGLSKRFGNKKNYGSRPEHTVNSSTGPLHWACKSLTKLGLVEPG-AQSGQRLTRKGHKFADSLAFQ 218
157876035  84 AVLRAIYLRPGVGYGGLSKRFGNKKNYGSRPEHTVTSSTGPLHWACKSLTKLGLVEPG-AQSGQRLTRKGHKFADSLAFQ 162
156087679  81 AILRHLYFHPDEGIGRLRRVYASRKRRGCAPNHTCPASGKIIRTIVQQLEANGFLEKSkDNKGRRLSRRGCNIVNEFARH 160
71026324  161 LTREVINRA 169
124505571 162 INKKVYNKE 170
85001381  161 LTREVISRT 169
73537065  151 VQIRKFGQS 159
154336559 151 VQIRKFGAS 159
146093379 151 VQIRKFGQS 159
146099358 170 VQIRKFGAS 178
154331729 219 VQIRKFGQS 227
157876035 163 VQIRKFGAS 171
156087679 161 LTRSLLEKE 169
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap