Conserved Protein Domain Family
PTZ00093

?
PTZ00093: PTZ00093 
nucleoside diphosphate kinase, cytosolic; Provisional
Statistics
?
PSSM-Id: 173387
View PSSM: PTZ00093
Aligned: 17 rows
Threshold Bit Score: 270.441
Threshold Setting Gi: 66822753
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71030692    1 MDERTFVMVKPDGVHRNLVGEVLKRFELKGLKLVAAKFMMPSRELVEKHYSAHEGKPFFEELVNFVTQGPVFCTAWEGPN 80 
66822753    7 NKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKG 86 
66822329    7 NKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKG 86 
66357220   25 QVEQTYLMIKPDGIQRQVVGEIISRFEKRGYRIAAMKLTIATPAILEEHYAEHKGKPFLPGLIEKMT-GPVLCMVFEGVD 103
124514040   1 -MEKSFIMIKPDGVQRGLVGTIIKRFEKKGYKLIAIKMLNPTEEILKEHYKELSDQPFFKNLVAYISKGPVVAMVWEGVD 79 
84995144    1 MEERTFVMVKPDGVHRNLVGEVLKRFELKGLKLVAAKFMMPSRELVEKHYSAHEGKPFFDELVSFVGQGPVFCTAWEGPN 80 
156088507   1 -MERTYIMVKPDGVQRGLIGEILKRFEMKGLKLIAAKFEHPTMDVVAQHYCEHKDKPFFKDLCDFISHGPVFCMIWEGPE 79 
154343455   2 SSERTFIAIKPDGVQRGLVGEIISRFERKGFKLVALKMLQPTTEQAQGHYKDLASKPFFEGLVKYFSSGPIVCMVWEGKN 81 
156101507   1 -MEKSFIMVKPDGVQRGLVGTIIERFEKKGYKMIALKMLNPTNEILKEHYKELADKPFFNTLIEYISKGPVVAMVWEGVE 79 
221057430   1 -MEKSFIMVKPDGVQRGLVGTIIKRFEKKGYKMIALKMLNPTKEILKEHYKELADKPFFNTLVEYISKGPVVAMVWEGAE 79 
71030692   81 AVKVGRTLLGVTNPVESLPGTLRGDFGLTLSKNLVHASSSLEDSVTECNLWFKPDEFVSwTPNTHKWVL 149
66822753   87 VVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLT-EVKPNPNLY 154
66822329   87 VVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLT-EVKPNPNLY 154
66357220  104 VIAQARKMMGSTRPGEAAPGTIRADFCQQAGRNLIHGSDSAESAKREISLWFKPEEIQSyKLALSDYIF 172
124514040  80 MVKQGRKLIGETNPLTSNTGTIRGDFCLEVSKNVIHGSDSVASANKEINIWFKAEELTQwKHHMKEWIC 148
84995144   81 AVKVGRSLLGVTNPVDSAPGTLRGDFGLTLSKNLVHASSCLEDSVAECNLWFKPDEFVTwTPNASKWLL 149
156088507  80 AIKIGRNLVGLTSPVESAAGTIRGDFGVVKNFNIVHASSSAEDAARECALWFTPEQLVTwERSVGGWIY 148
154343455  82 VVKSGRVLLGATNPADSQPGTIRGDYAVDVGRNVCHGSDSVESAQREVAFWFKVEEIASwTSHSACQIY 150
156101507  80 IVSQGRKLIGETNPLSSNTGTIRGDFCLEVSRNVIHGSDSVASANREINIWFKADELVQwSHHSKPWIY 148
221057430  80 IVNQGRKLIGETNPLSSNTGTIRGDFCLEVSRNVIHGSDSVASANREINIWFKADELVQwSDHSKPWIY 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap