Conserved Protein Domain Family
PTZ00090

?
PTZ00090: PTZ00090 
40S ribosomal protein S11; Provisional
Statistics
?
PSSM-Id: 173384
View PSSM: PTZ00090
Aligned: 7 rows
Threshold Bit Score: 272.168
Threshold Setting Gi: 237837431
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71032131    1 MYKCvSLGRKiGNSLFDQVNRILTRNVVNFNDFSILRDLWRFG-----GIKVGASSDLTRCVSFRSMTTGSEESREKPVL 75 
84999630    1 MYRC-SFGKSvVNLFFHQVNHILTRNTVNFSDFSKLRNFNPLG-----GINPGSSIPLARCVSVRRMTTASAESQDRPVL 74 
124809820   1 -----------MNVLSKNKSLVNYKTIFSSPIYMNICINHFVNklinvYSAKSLKFTTLSSDAVKAITNLKESVKKPDKK 69 
156100233   1 MIKViSALRK-GAFLRTYKELTPPWGSNTSGNSLLCKRSLIKG-----TNPPSRSYTTLSEEAVKAITNLKEVVKKPDKK 74 
156085848   1 ----------mASRLMSYTDKRFICGIHYEKVLPNLFMSKFSG-----HTSRCSGFSSSSDAKLKAITS------SLPGK 59 
237837431     --------------------------------------------------------------------------------    
221059367   1 MIKViSSLRK-GAILGTFKELISPWCCNRSSNSLLCKRSLING-----TITPSKSYTTLSEDAVKAITNLKEVVKKPDKK 74 
71032131   76 SKTLTKQELKNFQGNYQRYRRNFGLPEFHNVDLDRNGLIIEPTDRFMLVLTTSKNNVHAQLVNRSKNYRTVFGSFAGNVG 155
84999630   75 SKTLTKQELKNFQGNYQRYKRNFGLPEFHNVDLDRNGLIIEPTDRFMLVLTTSKNNVHAQLVNRSKNYKTVFGSFAGNVG 154
124809820  70 KKNITRETLKNCQGHKRRYKLFGDREEFHNIDRDKNNLIIEPTDSFRAVITTSKNNVHIQVVNKSKNYKTIFGSFAGNVG 149
156100233  75 KKNITRETLKNCQGHKRRYKLFGEREEFHNIDRDKNNLIIEPTDSFRAVITTSKNNVHVQVVNKSKNYKTVFGSFAGNVG 154
156085848  60 NRMMTKAELKNFPGHLQRYKKYGGLPEFHNIDRNRHGLITLPTDRFMLVLTTSKNNVHAQLVNRSRNYRTVFGSFAGNVG 139
237837431   1 --------MRTLGGHPRRFKLMGGRPEFHHVDRNKNGHIIEPTDKFQVVITTSKNNVHAQVVNKSRAYRTIFGSFAGNVG 72 
221059367  75 KKNITRETLKNCQGHKRRYKLFGDREEFHNIDRDKNNLIIEPTDSFRAVITTSKNNVHIQVVNKSKNYKTVFGSFAGNVG 154
71032131  156 YRKKMQQTDKCAYRIGENIARKCKRLGIFAVDVKFRRIARVENVLQAFHAIGLQVSQLIHEPRLPKTGVNSVRPRRRRRV 235
84999630  155 YRKKMQQTDKCAYRIGENIARKCKRLGIFAVDVKFRRIARVENVLQAFHALGLQVSQLIHESRLPKTGVNSVRPRRRRRV 234
124809820 150 FTKTLQQSERCAYRIGENIAKKCRRLGIFSIDIKFRRIMRVETVLQAMYANNLNITQIIHEPRLPKCGLNASKPRKRRRV 229
156100233 155 FTKSLQQSERCAYRIGENIAKKCRRLGIFSIDIKFRRIMRVETVLQAMYANNLNITQIIHEPRLPKCGLNASKPRKRRRV 234
156085848 140 INKKQQQSERCAYRIGENMAKKCKRLGVFAVDVKFRRLMRIETVLQAFQAEGLQVGQLIHEPRLPKTGINSVRPRRRRRV 219
237837431  73 IRKQAQQGTQCAYRIGQNIARKCRRLGISQVEIKFRRIMRVNQLLQAFTAHGLGVTAIAHEPRLPKCGQNATKPRKRRRV 152
221059367 155 FTKTLQQSERCAYRIGENIAKKCRRLGIFSIDIKFRRIMRVETVLQAMYANNLNITQIIHEPRLPKCGLNASKPRKRRRV 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap