Conserved Protein Domain Family
PTZ00089

?
PTZ00089: PTZ00089 
transketolase; Provisional
Statistics
?
PSSM-Id: 173383
View PSSM: PTZ00089
Aligned: 13 rows
Threshold Bit Score: 1033.47
Threshold Setting Gi: 159108690
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
237840945  30 ELGATDVLCVNTIRCLGADLPTIANSGHPGAPMGMAAMAHALWGYVLRHSGKHPQWFNRDRFVLSNGHACALLYSMLHLT 109
86170850    4 MDNEIDTKCINEIRMLSAELPLEAKSGHQGAPIGCAPIAHILWSYVMNYYNEDTKWINRDRFILSNGHASALLYTMLYLT 83 
156100865   1 MNGEIDEKCINEIRMLSAELPLKANSGHQGAPIGCAPIAHILWAYVMNYYNEDTSWMNRDRFVLSNGHASALLYTMLYLT 80 
146088164   1 --MASIEKIANCIRCLAADIVQGGKSGHPGTPMGMAPVSAVLWTEVMKYNSQDPNWVDRDRFVMSNGHGCALQYALLHMA 78 
167520145  10 MQDDLSKLCVNTIRVLAADTVQKASSGHPGAPMGCAPMAHALWSAVMNYNPSNPRWFNRDRFVLSNGHACALQYCMLHLT 89 
157870347   1 --MAAIEKVANCIRCLAADIVQGGKSGHPGTPMGMAPVSAVLWTEVMKYNSQDPNWVDRDRFIMSNGHGCALHYALLHMA 78 
159108690   1 MLDGIDGRCINAIRCLSVDQVNAANSGHPGTPIGFAPAAYILFKEFLQFDPSDPLWINRDRFVLSNGHASPLIYSLLHLF 80 
154338507   1 --MASIEKVANCIRCLAADIVQGGNSGHPGTPMGMAPVSAILWTEVMKYNSQDPHWADRDRFVMSNGHACALQYALLHMA 78 
71661828    2 NNSKKDELVANCIRCLAADVVQEANSGHPGTPMGMAPIAHVLWSEVMKYDSKDPSWMDRDRFVLSNGHACALQYAMLHLA 81 
66823383    4 IDFKALERAANETRGLSMDAVAKAASGHLGLPLGSAEIGAALFGNSLIYNPKDTRWLNRDYFVLSAGHGSMFLYSWLHLS 83 
66822027    4 IDFKALERAANETRGLSMDAVAKAASGHLGLPLGSAEIGAALFGNSLIYNPKDTRWLNRDYFVLSAGHGSMFLYSWLHLS 83 
72393293    1 -MSFNDNLATNSIRCLAADGVQQAKSGHPGAPMGMAPIAYVLWSEVMKFDSKDPEWIDRDRFVLSNGHASMLQYVMLHLS 79 
221058116   1 MNGPIDQKCINEIRMLSAELPLKANSGHQGAPIGCAPIAHILWAYVMNYYNEDTEWMNRDRFVLSNGHASALLYTMLYLT 80 
237840945 110 GYDMSLEDLRQFRQLHSKTPGHPEAHYAAGIETTTGPLGQGISNAVGLALASEYMSAKFNKDGFPLFDNHVFVFCGDGCL 189
86170850   84 EQGLSMEDLKSFRQFGSLTPGHPENHITKGVEVTTGPLGQGASNAVGMAIAAHNLADKYNTEEHKIFDNYVYAICGDGCM 163
156100865  81 KQGLTMEDLKNFRQLESLTPGHPEKHITKGVEVTTGPLGQGASNAVGMAICAHNLAQKYNTQEFPIFNNYVYAICGDGCM 160
146088164  79 GYDLTMDDLKGFRQDGSRTPGHPERFVTPGVEVTTGPLGQGIANAVGLAMAESHLAARFNRPGHELVNHYTYVYCGDGCL 158
167520145  90 GYDMTMDDLKSFRQVESRTPGHPENHLTEGIEVSTGPLGQGLSNAVGLALAEKHLAATFNRPGFDMVDHHTFVICGDGCL 169
157870347  79 GYDLTMDDLKGFRQYGSRTPGHPERFVTPGVEVTTGPLGQGIANAVGLAMAESHLAATFNRPGHELVNHYTYVYCGDGCL 158
159108690  81 GYNLSMDDLRHFRQLGSHTPGHPERDISRGIEITTGALGQGIGSAVGMALASKCAAAQYP----GVFTNKVICVVGDGCL 156
154338507  79 GFDLTMDDLKRFRQEDSRTPGHPERFVTSGVEVTTGPLGQGIANAVGLAMAEAHLAATFNRPGHEIVNHHTYAYCGDGCL 158
71661828   82 GYNVSMEDLKKFRRLGSRTPGHPERGFTTGIEVTTGPLGQGIGEGVGLAIAEAQLAATYNRPGHNIIDHWTYVFCGDGCL 161
66823383   84 GYDVSIEDIKNFRQLNSKTPGHPKFHDTPGVEATTGPLGQGIANAVGIASACKMAAGKFNTEQHQIFNQKVVVLVGDGCL 163
66822027   84 GYDVSIEDIKNFRQLNSKTPGHPKFHDTPGVEATTGPLGQGIANAVGIASACKMAAGKFNTEQHQIFNQKVVVLVGDGCL 163
72393293   80 GYDLSMDDLKKFRQLNSRTPGHPERGVTPGVEVTTGPLGQGIAQGVGLAIAEAQLAATYNRPGYNIIDHWTYVFCGDGCL 159
221058116  81 NQGLSMEDLKNFRQLGSLTPGHPEKHITKGVEVTTGPLGQGASNAVGMAICAHNLAEKYNTKEFPIFDNYVYAICGDGCM 160
237840945 190 EEGVSSEACSLAGHLGLHRLTVLYDDNNITIDGELHLAFSEKVQQRFKAYDWHVDVVDDGN-TDVAGLVQAMENAKKRT- 267
86170850  164 QEGVFCEAASLAGHLGLGRLILLYDDNKITIDGNTDLSFTENIEKKFEALNWEVRRVEDGN-KDYKKILHEIEQGKKNL- 241
156100865 161 QEGVFCEAASLAGHLGVGRLILLYDDNKITIDGNTELSFTEDIEKKFEGLKWEVRKVPNGN-TDFAGILTQIEEAKKNT- 238
146088164 159 MEGVCQEALSLAGHLALEKLIVIYDSNYICIDGATNLSFTEQSHQKYVSMGFHVIEVENGD-TDYDGLRKALAEAKATK- 236
167520145 170 QEGVSAEASSLAGHLRLGKLIVLYDDNQITIDGETELSFGEDVLKRYEAYGWHVSSVSKGDsTDPAELLKAIEDAKAVT- 248
157870347 159 MEGVCQEALSLAGHLALEKLIIIYDSNYICIDGATNLSFTEQSHQKYVAMGFHVIEVENGD-TDYDGLRKALAEAKATK- 236
159108690 157 QEGVSAEASSLAGRLQLNNLIVLYDDNGITIDGKTAISFTEDVARRYQAYGWQVLEVKNGN-TGLEELRSVIGKAYTSLl 235
154338507 159 MEGVCQEALSLAGHLGLEKLIVIYDSNHICIDGSTDLSFTESCTQKYVSMGFHVIEVCNGD-SDYDGLRKALAEAKATK- 236
71661828  162 MEGIGQESLSLAGHLGLEKFVLVYDSNHISIDGSTDLAFTEQPKQKYESMGFHVIMVDNGD-TGFDAIREAFEECKKVK- 239
66823383  164 QEGISQEAISFAGHHRLDNLIVFYDSNDVTLDAMAIETQSEDAVKRFESVGFEVQLVLEGN--NIGSLINAYQNAKHSKs 241
66822027  164 QEGISQEAISFAGHHRLDNLIVFYDSNDVTLDAMAIETQSEDAVKRFESVGFEVQLVLEGN--NIGSLINAYQNAKHSKs 241
72393293  160 MEGIGQEALSLAGHLGLEKLVVVYDSNRISIDGSTDIAFTEDAAKKYEALGFHVIPVSNGD-SDFTALRAAFAECKQIK- 237
221058116 161 QEGVFCEAASLAGHLGLGRLILLYDDNKITIDGNTELSFTENIEQKFEAFKWEVRKVDNGN-TDFEGILKQIEEAKKNK- 238
237840945 268 DKPTLICVRTTIGFL-SSKAGTAKVHGSPLSEEELRAVKEQCGLSPDEKLQIPEEVKQFYAQVQERGERSVEAWNALFER 346
86170850  242 QQPTLIIVRTACGFG-TKVEGTCKSHGLALNDEDLKNAKSFFGLDPQKKFHISDEVKEFYKNVIQKKKENYIKWKNMFDD 320
156100865 239 KQPSLIIVQTACGYG-TKVEGTCKSHGLALKEEDLKKTKELFGLDPEKQFHISEEVKNFYENIVEKKKENYLKWKKMFCD 317
146088164 237 GKPKMIVQTTTIGFG-SSKQGTEKVHGAPLGEEDIANVKTKFGRDPNKKYDVDEDVRAVFKMHMEKCSAEQKAWEERLAK 315
167520145 249 DKPSIIKVRTVIGIG-SQNQGTEKVHGSPLGDEDLAQVKKLYGFDPEASFVVSDEVYEFYKKRADLGREAAANWDKLLAE 327
157870347 237 GKPKMIVQTTTIGFG-SSKQGTEKVHGAPLGEEDIANVKTKFGRDPNKKYDVDEDVRAVFRTHVEKCSAEQRAWEERLAK 315
159108690 236 SCPTLVIIKTTIGYG-TAKQGTAAVHGAPLG-ESTRQFKELIGVNPDLEFHVSDEVRNNFESIIAKKKAAHAKWTKNV-- 311
154338507 237 GKPKMIVQTTTIGYG-SSKQGTEKVHGAPLGDEDIASVKTKFGRDPSKKYHVDEDVRSAFQKHVEKCAMEQKAWKERLAK 315
71661828  240 GKPKLIVLNTTIGFG-SGLAGTEKVHGAPLGDSDIQQLKRRFGRDPSKKFYVEEEVYDVFKQHVAVCEQKHEAWKAAMKK 318
66823383  242 GKPQIIICKTTIAKGiPEVAGTNKGHGEA-GVKFIDSARKNLGL-PEEKFFVSGETRQYFEQHEKQLEKLYQEWQATFAE 319
66822027  242 GKPQIIICKTTIAKGiPEVAGTNKGHGEA-GVKFIDSARKNLGL-PEEKFFVSGETRQYFEQHEKQLEKLYQEWQATFAE 319
72393293  238 GRPKLVIVNTTIGYG-CRLAGSEKAHGAPLGDDEVARVKEQFGLDPTKKFHVQPEVYGIFGKNAERGASRHEEWRVRMRK 316
221058116 239 KQPSLIIVKTSCGYG-TKVEGTCKSHGLALKEEDLKKTKQLFGLDSEKQFHISEEVKKFYEQIVQKKKENYLKWKKMFYD 317
237840945 347 YKKEYPSEGEEIERMFSH-------KLRPEVLETLKTLgeKAKEKADSTRAHSGRMLLGIKDFM--PELIGGSADLTGSN 417
86170850  321 FSLKYPQVSQEIIRRFQN-------DLPNNWKDALPKY--TPKDAPGATRNLSGIVLNSINKIF--PELIGGSADLSESN 389
156100865 318 FTVKYPETAQEIMRRFSK-------ELPHNWVEVLPKY--TTSDAPGATRNLSGVALNCINKIL--PELIGGSADLTESN 386
146088164 316 YTAAFPAEGAAFVAQMKG-------ELPSGWEAKLP-----TNSSAIATRKASENCLAVLFPAI--PALMGGSADLTPSN 381
167520145 328 YRSKFPELAADFERRMKG-------DLPEGWEKELPAY--TSESKAEATRKYSMFTLEKLVPTL--PELVGGSADLTPSN 396
157870347 316 YTAAFPAEGAAFVAQMKG-------ELPPGWEAKLP-----TNSSAIATRKASENCLAALFPAI--PALMGGSADLTPSN 381
159108690 312 FERLAPDVRVTIERRFKGlehrtlsELFAKADHEYEKLvaANVGKRLASRQMSQQILDLLATHVlgDSMLIGSADLASSN 391
154338507 316 YMAAFPAEGSAFVAQMKG-------ELPAGWEAKLP-----TNCSPIATRKASENCLAVLFQAI--PALIGGSADLTPSN 381
71661828  319 YAAEFPKEAAALEAQLKG-------ELPSGWKSQLP----LNDASKIATRKASENTLGTLFSII--SGLIGGSSDLTPSN 385
66823383  320 WKSANPKLAQLLESAHEK-------HEAIDIMKQIPE---FPTTPIIATRKAGSDVLQPISQYL--PLSVSGSADLHGST 387
66822027  320 WKSANPKLAQLLESAHEK-------HEAIDIMKQIPE---FPTTPIIATRKAGSDVLQPISQYL--PLSVSGSADLHGST 387
72393293  317 YTEEFPQEADALQNQLDF-------KLPPDWKSKLP-----LNDKSIATRKASENALGALLTLT--PALVGGSADLSPSN 382
221058116 318 FTVHYPEKAQEIMRRFSK-------ELPHNWVDVLPKY--TTSDVPAATRNLSGVVLNCINKIL--PELIGGSADLTESN 386
237840945 418 CTDLKEPS---FQVANRSG-RYIHFGVREHAMIAMANGLYHFGCMRPFCATFLNFVTYGWGAVRLAALSKCGVLVVATHD 493
86170850  390 CTSLKEENd--IKKNSYGN-KYIRFGVREHGMVAITNGLYAYGGFKPYCGTFLNFYTYAFGALRLAALSNHHILCIATHD 466
156100865 387 CTALKEEKd--ITRDSFAN-KYIRYGVREHGMVAITNGISAYGGFEPFCATFLNFYTYAFGALRLAALSQYHIFCIATHD 463
146088164 382 LTRPASANlvdFSSSSNEG-RYIRFGVREHAMCAILNGLDAHGGIIPFGGTFLNFIGYALGAVRLAAISHHRVIYVATHD 460
167520145 397 LTKVKGNDl-dFSHKHPEG-RYIRFGVREHAMAAVCNGMAAHGGIIPFGATFLVFTGYAFGAVRLSALSHFRVIYVMTHD 474
157870347 382 LTRPASANlvdFSSTSQEG-RYIRFGVREHAMCAILNGLDAHGGVIPFGGTFLNFIGYALGAVRLAAISHHRVIYVATHD 460
159108690 392 LTKVSAFTa--VADGFTKGsNYVNYGVREHAMAAISNGIGAHGGFVSFDATFLMFFSYCCAGIRNGALSEVPAIHVFTHD 469
154338507 382 LTRPASANltdFAPGSYEG-RYIRFGVREHAMCAILNGLDAHGGLIPFGGTFLNFVGYALAAVRLAALSHHRAIYVATHD 460
71661828  386 LTRPNSAAltdFQKATPQG-RYIRFGVREHAMCAIMNGIHAHGGFIPFGGTFLNFFGYALGAVRLSSLSHHQVIFVATHD 464
66823383  388 LNYIKEGRd--FTPACPTG-RNIKFGIREHAMGAMMNGIAYHGLFKVSGATFLVFSDYLRPAIRLAALSHLPVVYIFTHD 464
66822027  388 LNYIKEGRd--FTPACPTG-RNIKFGIREHAMGAMMNGIAYHGLFKVSGATFLVFSDYLRPAIRLAALSHLPVVYIFTHD 464
72393293  383 LTRPGSAQmvdFQKDTPHG-RYIRYGVREHAMCAVMNGMHAHGGFVPYGGTFLNFIGYALGAVRLASLAHHHVVYVATHD 461
221058116 387 CTALKEEKd--ITKDSFAN-KYIRYGVREHGMVAITNGIYAYGGFEPFCATFLNFYTYAFGALRLAALSQYHIFCIATHD 463
237840945 494 SIELGQDGPTHQPIEVLALCRATPNLIAIRPADGTEVAGAYAVWLRDe----------------------LKRVTVLSLC 551
86170850  467 SVELGEDGPTHQPIEVLSLLRSTPNLNIIRPADGNEVSGAYLSHFSN-----------------------PHTPTVIALC 523
156100865 464 SVELGEDGPTHQPIEVLALLRATPNLNVIRPADGNEVSGAYLCHFKN-----------------------LKTPTLVALC 520
146088164 461 SIGVGEDGPTHQPVELVAALRAMPNLQVMRPSDQTETSGAWAVALSS-----------------------AHTPTVLCLS 517
167520145 475 SIGLGEDGPTHQPVETLASARAIPNLLVIRPADGNETSGAYKAALLQ-----------------------SSTPSILSLS 531
157870347 461 SIGVGEDGPTHQPVELVAALRAMPNLQVIRPSDQTETSGAWAVALSS-----------------------AHTPTVLCLS 517
159108690 470 SFFLGEDGGTHHPIETVAWIRSMPRVIDWRPCSLAEVYGVYMTALADdvkitihgngtglqakdphtypmSKLQHIVCLS 549
154338507 461 SIGLGEDGPTHQPVELVAALRAMPNLQVIRPSDQTETSGAWAVAVTS-----------------------ARTPTVLCLS 517
71661828  465 SIGLGEDGPTHQPVELLAFLRAMPNLLVFRPSDQTETSAAWALALEN-----------------------AKGPSIICLS 521
66823383  465 SVGVGEDGPTHQPVETVSGLRMIPNLDVIRPADPEETAAAFSLAYAR-----------------------ADGPTLLSLT 521
66822027  465 SVGVGEDGPTHQPVETVSGLRMIPNLDVIRPADPEETAAAFSLAYAR-----------------------ADGPTLLSLT 521
72393293  462 SIGVGEDGPTHQPVELLALLRATPNLLVFRPSDQTETSAAWALALEN-----------------------TRGPSILCLS 518
221058116 464 SVELGEDGPTHQPVEVLALLRATPNLNVIRPADGNEVSGAYLCHFKN-----------------------PKTPTIVALC 520
237840945 552 RSSVPVLQGSSF---DGVIKGAYVLSD-------FENNg-kKKVVIAGSGSEVHFCVEAKKLLTN---NWDVRLVSMPCW 617
86170850  524 RNKVPHLNNTQP---EQVLKGAYILED-------FDTSn-nPKVILTGSGSELHLCFEAKEILKNq-hQLNVRIVSFPSW 591
156100865 521 RNKVPHLKNTSA---EQVLKGAYVLED-------FNNSndkQKVILAGCGSELHLCFEAKSILTEq-hNLNVRIVSFPSW 589
146088164 518 RQNTVPQSGSSI---DGVKRGAYAVVE-------VPD----PQLVIVASGSEVSLAVDAAKVLSGe---LCVRVVSMPCQ 580
167520145 532 RQGCANIAGTSI---DGVLKGAYVVRN-------ADP----PSIILTATGSELQLVMQAVDDLEAd--GHKVRVVSFPCW 595
157870347 518 RQNTVPQSGSSI---EGVKRGAYAVVE-------VSD----PQLVIVASGSEVSLAVDAAKALSGe---LCVRVVSMPCQ 580
159108690 550 RQALDDVPNSSA---RAVLKGAYSVHEtgglgafTTNItdgKHLILLSSGSEVGLCLKATDALVKqipEASVRVVSMPSY 626
154338507 518 RQNTVPQPGSSI---EGVKRGAYPLAE-------VPN----PQLVIVASGSEVSLAVDAAKALSGe---LRVSVVSMPCQ 580
71661828  522 RQNTVPQSASSM---DGVAKGAYVIHS-------ADK----PQLVLVSSGSEVSLAVDAAKALAAe---LRVAVVSMPCQ 584
66823383  522 RQNLPFLPGTAQkkrEGTLRGGYIVVS-------ETAP---LRMILIATGSEVQHCVEAAKLLGDd-----IRVVSMPCT 586
66822027  522 RQNLPFLPGTAQkkrEGTLRGGYIVVS-------ETAP---LRMILIATGSEVQHCVEAAKLLGDd-----IRVVSMPCT 586
72393293  519 RQNTVPQPTSKL---EGVAKGAYILIP-------AEK----PQLIIVSSGSEVSIAVDAAKALSSe---VRTTVVSMPCQ 581
221058116 521 RNKVPHLKNTSA---EQVLKGAYILED-------FETSndkQKVILAGCGSELHLCFDAKNILTKe-hNLNVRIVSFPSW 589
237840945 618 TLFDEQPAEYRNQVLClserrQGKVLTAYVEAASPFGWE-KYFDVH---VGLPTFGGSAPAKALYEFFGFSPANIAKRIE 693
86170850  592 TLFKKQPEDYQYSVMMh---nHPNLPRFYIEPASTHGFD-TYFNVY---IGINQFGYSAPKNKIWEHLGFTPENIVQKVL 664
156100865 590 NLFQQQSEEYQQSVMMh---hDAKVVRFYIEPASTHGFD-TYFNVY---LGINQFGYSAPKNQIWEHLGFTPENIVRKVL 662
146088164 581 ELFDAQPDAYRKSVLT------EGVPVVSVEAYVSFGWE-KYSHAH---VGMSGFGASAPAGVLYKKFGITVEEVVETAR 650
167520145 596 ELFEQQSQEYKESIFP------DGVPVLSVEAGAATGWE-RYSHGQ---VCMSSFGHSGPGGEVMKYFGFNKQNVVEKAK 665
157870347 581 ELFDAQTDVYRKSVLA------EGVPVVSVEAYVSFGWE-KYSHAH---VGMSGFGASAPAGVLYNKFGITVEEVVETAR 650
159108690 627 TIFNSQPFSEQNAVLPcl--tTPGIPCLSVEPYTSFGIAgKYAHKS---VSIEDFSFSGKPDDLARHFNMTVTNVVDIAQ 701
154338507 581 ELFDAQSDKYRKSVFP------DGVPVVSVEAYLSFGWE-KYSHAH---VGMSGFGASAPAGALYKKFGITTGDVVTTAC 650
71661828  585 ELFDQQSVDYQKTVFP------DGVPVLSIEPYVNYGWE-KYSHYH---VGMPGFGASAPGGELYKQFNITTEHVAAMGR 654
66823383  587 ELFDRQSNEYKQSVLP-----SGCRNRIAMEAGVTSFWY-KYVGLDgkvIGIDRFGMSAPGNAVMKQLGMTSENLVNISK 660
66822027  587 ELFDRQSNEYKQSVLP-----SGCRNRIAMEAGVTSFWY-KYVGLDgkvIGIDRFGMSAPGNAVMKQLGMTSENLVNISK 660
72393293  582 ELFELQPVGYQQKVFP------EGVPVISIEPFVSTGWE-RYSHYH---IGMEGFGASAPADQLYEYFNITVNHAVEVGR 651
221058116 590 NLFRQQSEDYQQSVMMh---hDAKVVRFYLEPASTNGFD-TYFNVY---LGINQFGYSAPKNKIWEHLGFTPENIVLKVL 662
237840945 694 EFQAPF 699
86170850  665 AFMKNK 670
156100865 663 AFIEAH 668
146088164 651 RLTARF 656
167520145 666 KLAEFY 671
157870347 651 RLAARF 656
159108690 702 AMLAQN 707
154338507 651 KLVARF 656
71661828  655 KLAAKY 660
66823383  661 Q----- 661
66822027  661 Q----- 661
72393293  652 KLAKKY 657
221058116 663 AFIKAQ 668
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap