Conserved Protein Domain Family
PTZ00082

?
PTZ00082: PTZ00082 
L-lactate dehydrogenase; Provisional
Statistics
?
PSSM-Id: 173376
View PSSM: PTZ00082
Aligned: 12 rows
Threshold Bit Score: 503.838
Threshold Setting Gi: 209881253
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
84997734    2 ARNNKRKLISLIGSGNIGGIMGYLTQLTELADVNFFDIVPNIGAGKSLDIMHANSIQGKAYKCKGTNNYEDISGSDVCIV 81 
71034123    1 MSGIRRKLISLIGSGNIGGIMGYLSQLTELADTVFFDIVPNIGAGKSLDIMHANSIQGKAYKCKGTNNYKDIAGSDVCIV 80 
66362544   15 LKMIERRKIAVIGSGQIGGNIAYIVGKDNLADVVLFDIAEGIPQGKALDITHSMVMFGSTSKVIGTNDYADISGSDVVII 94 
124513266   1 --MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIV 78 
156087280  10 APVIKRNKISLIGSGNIGGVMAYLAQLKELGDVVLFDIAPKLGAAKALDIMHANAIYDTSQNVIGTTSYEDIAGSDVCII 89 
156099236   1 --MTPKPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIV 78 
209881253   1 --MTQRRRIAVIGSGQIGANVAYIAIKDNIADVVLFDIIEGIPQGKALDITHSATIFGSSSKVIGTNNYADIEGCDVVVI 78 
124513272   1 MTSVKHPKISVLGAGDIGCALAHMICEKNLGDVVLHDFRKDLPKGRALDILHTRPLNRSRINILGTNEITDIKDSLVVVV 80 
237840969 152 FFKMSRRKIGLIGGGNIGATLALLSAVKELGDVVMFDVVQDLPQGKCLDLYQLTPISGVDVRFEGSNDYSVLKDADVIIV 231
237838381   3 GTVSRRKKIAMIGSGMIGGTMGYLCVLRELADVVLFDVVTGMPEGKALDDSQATSIADTNVSVTSANQYEKIAGSDVVII 82 
221058893   1 --MAPKPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYEDLEGADVVIV 78 
67604962    1 --MIERRKIAVIGSGQIGGNIAYIVGKDNLADVVLFDIAEGIPQGKALDITHSMVMFGSTSKVIGTNDYADISGSDVVII 78 
84997734   82 TAGnsyeennstkiaapgkganftamkctmgkganftamectmgkgarLAKAP-TKSNEEWNRDDLVGYNSKIIRDVGEN 160
71034123   81 TAG---------------------------------------------LAKAP-AKSNEEWNRDDLVAFNAKIITEVAEN 114
66362544   95 TAS---------------------------------------------IPGRP-KD-----DRSELLFGNARILDSVAEG 123
124513266  79 TAG---------------------------------------------FTKAP-GKSDKEWNRDDLLPLNNKIMIEIGGH 112
156087280  90 TAG---------------------------------------------LAKLP-NKSDDEWSRDDLVAPNSKIMFTIGEN 123
156099236  79 TAG---------------------------------------------FTKAP-GKSDKEWNRDDLLPLNNKIMIEIGGH 112
209881253  79 TAS---------------------------------------------VSGRP-KD-----DRSELMFNNARILDSVAEG 107
124513272  81 TIE---------------------------------------------VSEREfAEFDEEDLEKQVYTSNVKLLKEVAKS 115
237840969 232 TAG---------------------------------------------VPRKP-GM-----SRDDLLAINAKIMGQVGEA 260
237838381  83 TAG---------------------------------------------LTKVP-GKSDKEWSRNDLLPFNAKIIREVAQG 116
221058893  79 TAG---------------------------------------------FTKAP-GKSDKEWNRDDLLPLNNKIMIEIGGH 112
67604962   79 TAS---------------------------------------------IPGRP-KD-----DRSELLFGNARILDSVAEG 107
84997734  161 IKKYAPEAFVIVITNPMDVMVHLMLKVTGFPKNMVVGMGGLLDSSRMNCYIAEKLGVNPKYVHGSVIGAHGDSMIPLVSR 240
71034123  115 IKKYAPKAFVIVITNPMDVMVHLMLKVTGFSKNMVVGMGGLLDSSRMNCYIAEKLGVNPKYVHGSVIGAHGDSMIPLVSR 194
66362544  124 VKKYCPNAFVICITNPLDVMVSHFQKVSGLPHNKVCGMAGVLDSSRFRTFIAQHFGVNASDVSANVIGGHGDGMVPVTSS 203
124513266 113 IKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRY 192
156087280 124 IKKYAPNAFVICITNPLDVMVKMLLKSTGFPKNKVVGMGGLLDSSRMCHYIADKLRVNPRYVHGSCIGGHGDSMIPLTNH 203
156099236 113 IKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRY 192
209881253 108 VKTYCPNAFVICITNPLDVMVAYFQKASGLPQNRVCGMAGVLDTSRFRTLIAEYFGVNTSDVSANVIGGHGDTMVPVISS 187
124513272 116 LKKHCPQAFVVVTTSPVDCMAKVLQEHANIPPHKICGMAGVLHSARLRHNLAEKLRVNPGDVQGFVIGAHGDKMVPLPRY 195
237840969 261 IKQYCPNAFVICITNPLDVMVYILREKCGLPPHKVCGMAGVLDSARLRTFLSERLNVSVDDIHALVMGGHGDTMVPLPRF 340
237838381 117 VKKYCPLAFVIVVTNPLDCMVKCFHEASGLPKNMVCGMANVLDSARFRRFIADQLEISPRDIQATVIGTHGDHMLPLARY 196
221058893 113 IKKLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYLSQKLNVCPRDVNALIVGAHGNKMVLLKRY 192
67604962  108 VKKYCPNAFVICITNPLDVMVSHFQKVSGLPHNKVCGMAGVLDSSRFRTFIAQHFGVNASDVSANVIGGHGDGMVPVTSS 187
84997734  241 STVYGIPILQFVEQGYITMEDIKEIEERTVTSAFEILKLYGSGSSYFAPATAAIEMASSYLNDKKCVFPCSCYLEGQYGH 320
71034123  195 STVYGIPILDFVEKGYLTHEDIKEIEERTITSAIEILKLYGSGSSYFAPATAAIEMASAYLNDKKSVFPCSCYLEGQYGH 274
66362544  204 VSVGGVPLSSFIKQGLITQEQIDEIVCHTRIAWKEVADNLKTGTAYFAPAAAAVKMAEAYLKDKKAVVPCSAFCSNHYGV 283
124513266 193 ITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLH--ASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGH 270
156087280 204 VTVNGIPIQRFIERGEITQAELDKIAERTIGSGMELVQLYGNGSAFFAPATAAIEMASAYLSDKRSVIVCSCYLEGEYGH 283
156099236 193 ITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLL--ASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGH 270
209881253 188 ISVGGVPISSFIKQGLIGQPQLDEIVKKTRIAWKEIADLLRNATAFFAPAAAAVSMARAYLNDEKSIIPCSAYCEDSYGV 267
124513272 196 CCVNGIPLSDFTKKGAITEKEINQIVEKTRNTGFELLELLPEGSVCFAPSLAIVEIIEAYLKDLKRVLVCSVLLNGHYGH 275
237840969 341 TTVGGIPLPELVKMGMISQQEVDDIVQRTRNGGGEIVSLLKTGSAFFAPAAAGVLMAEAYLKDRKRVLPCAAYLNGEYGV 420
237838381 197 VTVNGFPLREFIKKGKMTEAKLAEIVERTKKAGGEIVRLLGQGSAYYAPALSAITMAQAFLKDEKRVLPCSVYCQGEYGL 276
221058893 193 ITVGGIPLQEFINNKKITDEEVEAIFDRTVNTALEIVNLL--ASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGH 270
67604962  188 VSVGGVPLSSFIKQGLITQEQIDEIVCHTRTAWKEVADNLKTGTAYFAPAAAAVKMAEAYLKDKKAVVPCSAFCSNHYGV 267
84997734  321 RDIYCGTPAVIGANGVEKVFELKLTPEEQDKYDASIKEIKRLEALIK 367
71034123  275 KEVYCGTPAVIGANGVEKVLELKLTPQEQQKFNDSIKEIRRLESLIK 321
66362544  284 KGIYMGVPTIIGKNGVEDILELDLTPLEQKLLGESINEVNTISKVLD 330
124513266 271 SDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA- 316
156087280 284 NDVYLGTPAIIGANGIEKIITLKLSAEEQAKLDASVKEIRRLEALVG 330
156099236 271 SNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI- 316
209881253 268 KGIYMGVPTVIGRNGIERIIELDLTPIERKWLVESISSVSNLCDVLE 314
124513272 276 KGVFAGIPVVIGGKGIEKIIELDLNTQEKELFDDSLKHISYLFDNYK 322
237840969 421 KDMYVGVPCVIGAGGVEKIVELDLTPEEKKMFERSVESVKTLLAAAP 467
237838381 277 HDMFIGLPAVIGGGGIEQVIELELTHEEQECFRKSVDDVVELNKSLA 323
221058893 271 KNIFGGTPLVIGGTGVEQVIELQLTAEEKAKFDEAVAETKRMKALI- 316
67604962  268 KGIYMGVPTIIGKNGVEDILELDLTPLEQKLLGESINEVNTISKVLD 314
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap