Conserved Protein Domain Family
PTZ00076

?
PTZ00076: PTZ00076 
60S ribosomal protein L17; Provisional
Statistics
?
PSSM-Id: 173371
View PSSM: PTZ00076
Aligned: 6 rows
Threshold Bit Score: 394.558
Threshold Setting Gi: 237843699
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156087118   1 MGFSATARLVAQGQRGRIFRKFRGQPPKRFDWIKNNLDRLLRYGRVELTLPRAKELQQYAEEVIFHAK-----------K 69 
124809000   1 MGYTSTLKFVNLGVRRRLFRRAHKQPHHKWDSIKNQLNELLKYGRIETTLTKAKELQGYAEELIYLAK-----------K 69 
156101942   1 MGYTSTLKFVNLGVRRRLFRRAHKQPHHKWDSIKNQLNELLKYGRIETTLTKAKELQGYAEELIYLAK-----------K 69 
71033123    1 MGFSVTCKFVSLGLRTRVFRKFRGQPNKSYDWIRNNVDKLIRNGRLELTLPRAKELQQYVEELIYHAKilkyiinfvklL 80 
237843699   1 MGWSKVVNFLNKGVQRRPHRRLPGQPHHQWNMLKTQLDQLVRSDRLELTLPRAHELQQYAEELVHFAK-----------Q 69 
221060136   1 MGYTSTLKFVNLGIRRRLIRRAHKQPHHRWDSIKNQLNELLKYGRIETTLTKAKELQGYAEELIYLAK-----------K 69 
156087118  70 DTPESDLVVESMLRTPEARHQLYEKYVPNYADRPFFFTRVVNQWRLRFADAAPMAYLEFVDRSGEIRPAKPVGTKKLVYI 149
124809000  70 DNVENNLKVESMLRTAQGRRRLYEFYVPLYRHRPFFFTRIINQWKLRLRDSAPLAYIEFIDRPGELRPAKPVGYNKIKFI 149
156101942  70 NNAENNLKVESMLRTAQGRRKLYEYYVPLYRYRPFFFTRVINQWRLRLRDAAPMAFIEFIDRPGELRPAKPVGADRIKYI 149
71033123   81 DTEDSDLLVESVIRTPECRSLLYEKYVPLYKDRQFFFTRVVNQYKLRQRDSAPLAYIELVNTENEIYPAKPVGIDKLNHI 160
237843699  70 NTPESSLIVESMIFTPAARRKLFHELCPLYANRPFFYTRVVNQHRLRMRDAAPMAYLEFVDRPGEIRPARPVGFERKQAI 149
221060136  70 NNVENNLKVESMLRTAQGRRKLYEYYVPLYRYRPFFFTRVINQWRLRLRDAAPMAFIEFIDRPGELRPAKPVGPDRIKYI 149
156087118 150 HDLMKRSRRDYRKYYNFAKTNGLLDRD-GNLLDDishlISKGEASWHENEEVASTINPQwYEHPQMRDRLDRIQSVNLVG 228
124809000 150 YEEMKKNRRNFRKYFNIAKRFHLLDEN-DHLLPDfadtGHVPEKSWYDEENEEDDDEII-INPELIQKYKKFNNPMLKGP 227
156101942 150 YEEMKKNRRNFKQYLHIARKFNLLDEN-DQLISDve-fDSLQEHARRDLWKRDDEEEIQ-VDPELIKRYEQFGEPMLAGP 226
71033123  161 LNLMKSTRRDYRKYHNYGRKMGLIDKD-GNLINK----IQINTKPWYEEGNIETVDETS-LSDEKVRRRLEMIRKVEVVN 234
237843699 150 WEEMQATRRGRRQWWNHAKKLGLIDEEtGDVISD----INALRRPSAAEWEESDSEEEK-ADSPSPYK-------MVAAP 217
221060136 150 YEEMKKNRRNFKQYFHIAKKFNLLDGN-DELISD---------------WKGDDEEEIQ-IDPELIKRYEQFGEPMLTGP 212
156087118 229 DRCTEVLDVPYTDPVEQPVATRNpdlskpiRRPRFNP 265
124809000 228 KKGREPFYVDLPLPSVTERTFLN-------YRKKFKP 257
156101942 227 TKGREPFYVDLPLPSHVERAFLN-------YRKKFKP 256
71033123  235 GKVIEPFNTLYQPNTATVKKTLR-----------FNP 260
237843699 218 KRALEPFFVDLPPPTERYRKQRY-------VFKRFRP 247
221060136 213 TKGREPFYVDLPLPSLVEKAFIN-------YRKKFKP 242
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap