Conserved Protein Domain Family
PTZ00066

?
PTZ00066: PTZ00066 
pyruvate kinase; Provisional
Statistics
?
PSSM-Id: 173361
View PSSM: PTZ00066
Aligned: 10 rows
Threshold Bit Score: 861.761
Threshold Setting Gi: 156088845
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66362152   13 LKRLASTSAVMSCTLGKATCLGMDKICSPLADNDVTQRKTQIICTIGPSCNNVESLIGLIDKGMSVARLNFSHGDHESHF 92 
71029198    1 MSFKRVMSSSSGDSIHQHSNISLQKVMREISYSDIRDKRTHIVCTMGPACGNVETIVKMIKSGMNICRFNFSHGNHETHT 80 
86171639    1 MSSFKYKNSAAGASMQSAANITLRQILEP-NNVNLRSKKTHIVCTLGPACKSVETLVKLIDAGMDICRFNFSHGSHEDHK 79 
84997059    1 MSFKRMISTSAGDSIHQHSNISLQKVMREISYSDIRDKRTHIVCTMGPACGNVETIIQMVKSGMNICRFNFSHGNHETHT 80 
156101167   1 MNSFKFKNSTTGASLQSAANITLRQILEP-STVDLRSKKTHIVCTLGPACKSVETLVQLIDAGMNICRFNFSHGSHDDHK 79 
156088845   1 ---MATMKDILGVEAAQLCDISLDTIRRPIQKNDLQNKHTHIVCTMGPALVSSDAIVELIDAGMNICRFNFSHGDHVSQK 77 
209881436   7 LNRLASTSTVMSCTLGKATCLGMDKICSPLCDEDITQRKTQIVCTIGPSSSDVETLIGLIDRGMSVARLNFSHGNHESHH 86 
237831251  19 VARLVSASSVMTQQLGKSTNIRMSQILEPRSEEDWTAHRTRIVCTMGPACWNVDTLVKMIDAGMNVCRLNFSHGDHETHA 98 
221057798   1 MNSFKFKNSTAGASLQSAANITLRQILEP-STVDLRSKKTHIVCTLGPACKSVETLVQLIDAGMNICRFNFSHGSHEDHK 79 
67601724    7 LKRLASTSAVMSCTLGKATCLGMDKICSPLADNDVTQRKTQIICTIGPSCNNVESLIGLIDKGMSVARLNFSHGDHESHF 86 
66362152   93 KTLQNIREAAKARPHSTVGIMLDTKGPEIRTGMLEGGKPIELKAGQTLKITTDYSMLGNSECISCSYSLLPKSVQIGSTV 172
71029198   81 KTLNLVKEALKSVPEANIGLMLDTKGPEIRTGFLKNHTPITLEAGKTLKITTDYTIEGDESIISCSYKKLPQSVKVGNII 160
86171639   80 EMFNNVLKAQELRPNCLLGMLLDTKGPEIRTGFLKN-KEVHLKEGSKLKLVTDYEFLGDETCIACSYKKLPQSVKPGNII 158
84997059   81 KTLNLVKEALKSVPEANIGLMLDTKGPEIRTGFLKNHTPITLEEGSTLKITTDYTIEGDETIISCSYKKLPQSVKVGNII 160
156101167  80 EMFNNVLKAQEQRPNALLGMLLDTKGPEIRTGLLKN-KEAHLKEGSKLKLVTDYEFLGDETCIACSYKKLPQSVKEGNII 158
156088845  78 QMLDKVREAMAKRPNANIGLLLDTKGPEIRTGLLKDHKAITLVHGQSLKITTDYTIEGDNECISCSYPMLTTSVKVGGII 157
209881436  87 KTLLNIREAAAARPHNTVGIMLDTKGPEIRTGMLENGQPITLKTGQMLKIVTNYSFVGNSECISCSYNLLPKSVQVGSNI 166
237831251  99 RTVQNIQEAMKQRPEARLAILLDTKGPEIRTGFLKDHKPITLQQGATLKIVTDYNLIGDETTIACSYGALPQSVKPGNTI 178
221057798  80 EIFNNVLKAQEQRPNALLGMLLDTKGPEIRTGLLKN-KEAHLKEGSKLKLVTDYDFLGDETCIACSYKKLPQSVKKGNII 158
67601724   87 KTLQNIREAAKARPHSTVGIMLDTKGPEIRTGMLEGGKPIELKAGQTLKITTDYSMLGNSECISCSYSLLPKSVQIGSTV 166
66362152  173 LIADGSLSTQVLEIGDDFIVCKVLNSVTIGERKNMNLPGCKVHLPIIGDKDRHDIVDFALKYNLDFIALSFVQNGADVQL 252
71029198  161 LIADGSLSCEVLAVFDDYIEVKVLNNAKIGEYKNMNLPGVKVELPVLTDSDKDYILNFGIPNQMDFIALSFTQTADEVRY 240
86171639  159 LIADGSVSCKVLETHEDHVITEVLNSAVIGERKNMNLPNVKVDLPIISEKDKNDILNFAIPMGCNFIAASFIQSADDVRL 238
84997059  161 LIADGSLSCEVLAVFDDYIEVKVLNNAKIGEYKNMNLPGVKVELPVLTESDKDYILNFGIPNQMDFIALSFTQTAEEVKY 240
156101167 159 LIADGSVSCKVLETHDDHVITEVLNSATIGEKKNMNLPNVKVDLPVIGEKDKNDILNFAIPMGCNFIAASFIQSAEDVRM 238
156088845 158 LIADGSLSCEVTEVHDKHIVVKVLNNATIGERKNMNLPGVKVELPVLGEKDINDIVNFAVPHNFDFIALSFAQSADDIKL 237
209881436 167 LIADGSLTAQVVEIGEDYVNTKVMCNATIGERKNMNLPGCKVNLPILSEKDKHDIVDFALKYGLDFIALSFVQSAADVQL 246
237831251 179 LIADGSLSVKVVEVGSDYVITQAQNTATIGERKNMNLPNVKVQLPVIGEKDKHDILNFGIPMGCNFIAASFVQSADDVRY 258
221057798 159 LIADGSVSCKVLETHDDHVITEVLNSATIGEKKNMNLPNVKVDLPVIGEKDKNDILNFAIPMGCNFIAASFIQSAEDVRM 238
67601724  167 LIADGSLSTQVLEIGDDFIVCKVLNSVTIGERKNMNLPGCKVHLPIIGDKDRHDIVDFALKHNLDFIALSFVQNGADVQL 246
66362152  253 CRQIISENTQYsngipssIKIISKIENLEGVINFDSICSESDGIMVARGDLGMEIPPEKIFVAQKCMISKCNVAGKPVVT 332
71029198  241 VRELLGEKGKH-------IKIIPKIENIEGLANYDEILEASDGIMVARGDLGMEMPIEKVCLAQKMMIKRANMCGKPIIT 313
86171639  239 IRNLLGPRGRH-------IKIIPKIENIEGIIHFDKILAESDGIMIARGDLGMEISPEKVFLAQKLMISKCNLQGKPIIT 311
84997059  241 VRELLGEKGKH-------IKIIPKIENIEGLANYDEILEASDGIMVARGDLGMEMPIEKVCLAQKMMIKRANMCGKPIIT 313
156101167 239 IRNLLGPRGRH-------IKIIPKIENIEGIINFDKILAESDGIMIARGDLGMEISPEKVFLAQKLMISKCNLQGKPIIT 311
156088845 238 CRKVLGEAGKH-------IKIIPKIENVEGLIHFDAILDEADGVMVARGDLGMEIPLEKVCMAQKYMIKKCNEKSKPVIT 310
209881436 247 CRQIIAEHADCstn-pipLKIISKIENLEGVINFDSICAESDGIMVARGDLGMEIPPEKIFVAQKCMITKCNIAGKPVVT 325
237831251 259 IRGLLGPRGRH-------IRIIPKIENVEGLVNFDEILAEADGIMIARGDLGMEIPPEKVFLAQKMMIAKCNVVGKPVIT 331
221057798 239 IRNLLGPRGRH-------IKIIPKIENIEGIINFDKILAESDGIMIARGDLGMEISPEKVFLAQKLMISKCNLQGKPIIT 311
67601724  247 CRQIISENTQYsngipssIKIISKIENLEGVINFDSICSESDGIMVARGDLGMEIPPEKIFVAQKCMISKCNVAGKPVVT 326
66362152  333 ATQMLESMIKSNRPTRAEMTDVANAVLDGSDCVMLSGETANGAFPFDAVNVMSRVCAQAETCIDYPVLYHAIHSSVPKPV 412
71029198  314 ATQMLESMVNNPRPTRAESADVINAVLDGSDCVMLSGETAGGKFPVECVKIMAKLCFEAENCLSTRDLMAESLLLNSSQF 393
86171639  312 ATQMLESMTKNPRPTRAEVTDVANAVLDGTDCVMLSGETAGGKFPVEAVTIMSKICLEAEACIDYKLLYQSLVNAIETPI 391
84997059  314 ATQMLESMVNNPRPTRAESADVINAVLDGSDCVMLSGETAGGRFPVECVKIMAKLCFEAENCLSTRDLMAESLLLNSSQF 393
156101167 312 ATQMLESMTKNPRPTRAEVTDVANAVLDGTDCVMLSGETAGGKFPVEAVTIMSKICLEAEACIDYKLLYQSLVGAIDTPI 391
156088845 311 ATQMLESMINNPRPTRAESCDVANAVMDGTDCVMLSGESANGKYPALCVQHMAKLCFEAESCSAYRKLFGKAIAETKTKV 390
209881436 326 ATQMLESMIKNNRPTRAEMTDVANAVLDGSDCVMLSGETANGAFPLEAVNVMARVCAQAETCIDYSVLYHAIHASVPKPV 405
237831251 332 ATQMLESMIKNPRPTRAEAADVANAVLDGTDCVMLSGETANGEFPVITVETMARICYEAETCVDYPALYRAMCLAVPPPI 411
221057798 312 ATQMLESMTKNPRPTRAEVTDVANAVLDGTDCVMLSGETAGGKFPVEAVTIMSKICLEAEACIDYKLLYQSLVGAIQTPI 391
67601724  327 ATQMLESMIKSNRPTRAEMTDVANAVLDGSDCVMLSGETANGAFPFDAVNVMSRVCAQAETCIDYPVLYHAIHSSVPKPV 406
66362152  413 AVPEAIACSAVESAHDVNAKLIITITETGNTARLISKYRPSQTIIACTAKPEVARGLKIARGVKTYVLNSIHHSEVVISN 492
71029198  394 TVQESIARSAVFLSIDIEAKMILVFTQTGRASRLVSKYRPRCLILSLSEDIHVVKSLSISRAVISVLVDSLEDTDKNVER 473
86171639  392 SVQEAVARSAVETAESIQASLIIALTETGYTARLIAKYKPSCTILALSASDSTVKCLNVHRGVTCIKVGSFQGTDIVIRN 471
84997059  394 TVQESIARSAVFLSIDIEAKMILVFTQTGRASRLVSKYRPRCLILSLSEDIHVVKSLSISRAVISVLVDSLEDTDRNVEH 473
156101167 392 SVQEAVARSAVETAESIGAVLIVALTETGYTARLIAKYKPSCTILALSASDSTVRCLNVHRGITCIKVGSFQGTDNVLRN 471
156088845 391 SDEEALARSAALLSMELHAAAIVCVSDDDKIIRHISKCRPVCPVFSYSPEPHVVKYMSVCRGVRAKCAPKLSNQEADVAA 470
209881436 406 AVPEAVACAAVESAHDLNAKIIIVITETGNTAQLISKYRPEHTIVACTAKAEVARSLKIARGVKTYVLNSILHSDGVISN 485
237831251 412 STQEAVARAAVETAECVNAAIILALTETGQTARLIAKYRPMQPILALSASESTIKHLQVIRGVTTMQVPSFQGTDHVIRN 491
221057798 392 SVQEAVARSAVETAESIGAALIVALTETGYTARLIAKYKPSCTILALSASDSTVRCLNVHRGITCIKVGSFQGTDNVLRN 471
67601724  407 AVPEAIACSAVESAHDVNAKLIITITETGNTARLISKYRPSQTIIACTAKPEVARGLKIARGVKTYVLNSIHHSEVVISN 486
66362152  493 ALALAKEESLIESGDFAIAVHGVKESCPGSCNLMKIVRCP 532
71029198  474 AINHAKLRDMLRKDDLIVVVHGARENVSGSSDLIKVVKIP 513
86171639  472 AIEIAKQRNMAKVGDSVIAIHGIKEEVSGGTNLMKVVQIE 511
84997059  474 AINHAKLRDMLRKDDLIVVVHGARENVAGSSDLIKVVKIP 513
156101167 472 AIEIAKERNLVKVGDSAICIHGIKEEVAGATNLMKVVQVE 511
156088845 471 AVASAKEAGTVNAGDSVVVVYAVGGTISTGNNSIRVVKA- 509
209881436 486 ALSLAKEQGLIESGEFAIAVHGVKEGCPGTCNLMKVVKCP 525
237831251 492 AIVVAKERELVTEGESIVAVHGMKEEVAGSSNLLKVLTVE 531
221057798 472 AIEIAKERNLVKVGDSVICIHGIKEEVAGATNLMKVVQVD 511
67601724  487 ALALAKEESLIESGDFAIAVHGVKESCPGSCNLMKIVRCP 526
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap