Conserved Protein Domain Family
PTZ00064

?
PTZ00064: PTZ00064 
histone acetyltransferase; Provisional
Statistics
?
PSSM-Id: 173359
View PSSM: PTZ00064
Aligned: 3 rows
Threshold Bit Score: 1069.25
Threshold Setting Gi: 209878286
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66475592    1 MVNMALRSRSSNIQKQQANNTPSNTSNNNEAVSSELISSENQRKKTNARIYSSIEEHSDKTLDECKEDEAVPtiekgpTA 80 
209878286   6 RSSLKISGSSSKFRPNSGTREFANLSEYDSPLEKLEFKNKGEDTEHICESRNELTNSSDANIEDNKTNLDIN------NN 79 
67612643    1 MVNMALRSRSSNNQKQQANNTPSNTSNNNEAVSSELISSENQRKKTNARIYSSIEEHPDKTLDECKEDEAVStiekgpTA 80 
66475592   81 DFPSVNQWVLALFEEEGKQMLARVVGWKLYGTQVTHLSHLVNKK---------TGGNKQNSLIKVSSSSNESQIK---ED 148
209878286  80 SFPTVNQWVLAYFDESAKYKLARIIGWKLIGESATHLLHLVENKdkyngylkvNSKNLSTNLVKLNSSIEKNRSSlnlVD 159
67612643   81 DFPSVNQWVLALFEEEGKQMLARVVGWKLYGTQVTHLSHLVNKK---------TAGNKQNSLIKVSSSSNESQIK---ED 148
66475592  149 YEFYVHFRGLNRRLDRWVKGKDIKLSFDVEELNDPVLIERFqkqgIKFISSLVVSNSANKSGNKSKKRNVGVLDISDGED 228
209878286 160 YEFYVHFRGLNRRLDRWITGKNIKVDFELEELDDFNLREKL----MRINSTLSPTHQNLKCVTKSRKRTIDQLQISDGED 235
67612643  149 YEFYVHFRGLNRRLDRWVKGKDIKLSFDVEELNDPILIERFqkqgIKFISSLGVSNSANKSGNKSKKRNVGVLDISDGED 228
66475592  229 PDEHEGMDHSAILDHEETTRLRTIGRVRIGKFILDTWYFSPLPDEYQNVDTLHFCEYCLDFFCFEDELIRHLSRCQLRHP 308
209878286 236 PEEHEGMDHAALQVHEETTRLKTISKIRIGKYILDTWYFSPFPDEYQNLEILHFCEFCLEFFRHEGELIRHIKGCILRHP 315
67612643  229 PDEHEGMDHSAILDHEETTRLRTIGRVRIGKFILDTWYFSPLPDEYQNVDTLHFCEYCLDFFCFEDELIRHLSRCQLRHP 308
66475592  309 PGNEIYRKDNISVFEIDGALTRGYAENLCYLAKLFLDHKTLQYDVEPFLFYIVTEVDEEGCHIVGYFSKEKVSLLHYNLA 388
209878286 316 PGNEIYRKENISIFEIDGALAKRYAENLCYLAKLFLDHKTLQYDVEPFLFYIVTEVDEEGCHLVGYFSKEKISLMHYNLA 395
67612643  309 PGNEIYRKDNISVFEIDGALTRGYAENLCYLAKLFLDHKTLQYDVEPFLFYIVTEVDEEGCHIVGYFSKEKVSLLHYNLA 388
66475592  389 CILTLPCYQRKGYGKLLVDLSYKLSLKEGKWGHPERPLSDLGRAIYNNWWAHRISEYLLEYFKQNKICerggSKQPLQVS 468
209878286 396 CILTLPCYQRKGYGKLLVDLSYRLSISEGKWGHPERPLSDLGRAIYKSWWNAKIPEVLLEGMKSKELL----NKQAIGSV 471
67612643  389 CILTLPCYQRKGYGKLLVDLSYKLSLKEGKWGHPERPLSDLGRAIYNNWWAHRISEYLLEYFKQNKICerggSKQPLQVS 468
66475592  469 NYSKFIDNVVRSTGIRREDVIRILEENGIMRNIKDQHYIFCNQEFLKGIVKRSGRPGITLIDKNFNWVPFSRAPPSEVES 548
209878286 472 KHWITIESIIRRTGIRREDVLKTLEDNGILRTFYKRKLLYCEFKFLENIIKHTGRPGYPLYDDYFSWVPYNRSSPSSVEA 551
67612643  469 NYGKFIDNVVRSTGIRREDVIRILEENGIMRNIKDQHYIFCNQEFLKGIVKRSGRPGITLIDKKFNWVPFSRAPPSEVES 548
66475592  549 LPQE 552
209878286 552 LPID 555
67612643  549 LPQE 552
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap