Conserved Protein Domain Family
PTZ00061

?
PTZ00061: PTZ00061 
DNA-directed RNA polymerase; Provisional
Statistics
?
PSSM-Id: 173356
View PSSM: PTZ00061
Aligned: 11 rows
Threshold Bit Score: 295.201
Threshold Setting Gi: 66802850
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71029810    1 MDDEEGRLFRCRRTCCEMLEDRGYFIPVQEKLETFAEFKARYEMHEKVRSKMLLVASQRTASENKLLVYFADEKKKTGVK 80 
66358302   10 MDSSDNRFFRARRTLCEMLEDRGYIVSSQDKEEDFSTFKERFESHQRLRSRMLMVASHRQDQTKRIICYFADESKKTGVK 89 
84997627    1 MDDEEGRLFRCRRTCCEMLEDRGYFIPSQEKLETFAEFKARYEMYDKVRSKMLLVASLRTAAENKLLVYFADEKKKTGVK 80 
124514006   1 MEDPVTRFYKCRKTCCEMLEDRGYIMTPREKLENFSTFKEMFEDNDRQRSKMGISTTHKNDSNNRIIVYFADEVKKTGVK 80 
156089419   1 MDDEEGRLFRCRRTCCEMLEDRGYFIPNQERLETFAEFKARYELYDRVRSKMLLVASLKTDKDAKLLVYFADETKKTGVK 80 
156101473   1 MEDPITRFYKCRKTCCEMLEDRGYIITPREKLENFATFKEQFEENEKLRSRMTIITSHKNDANNKIIVYFADEIKKTGVK 80 
209878710   1 MDNSDTRFFRARRTLCEMLEDRGYIVSSQDKDEQFATFKERFESHQRLRSRMLMVASHKQDQTKRIICYFADESKKTGVK 80 
66802850    1 -----------------MLSDREYIITAYEQEYPRESFVS--------RENLTMYCVKKDDPTDSIYVFFPD-TPKVGVT 54 
237834761   1 MEDSTRRLFRARKTCCDMLQDRGYIVSAQEKNESWNDFLQRFKENECNRSRMLLIASHKVDPDNRVIVYFADETKKTGVK 80 
221057466   1 MEDPITRFYKCRKTCCEMLEDRGYVITPREKLENFATFKEQFEENEKLRSRMTIITSHKNDESNKIIVYFADETKKTGVK 80 
67624263    1 MDSSDNRFFRARRTLCEMLEDRGYIVSSQDKEEDFSTFKERFESHQRLRSRMLMVASHRQDQTKRIICYFADESKKTGVK 80 
71029810   81 PIRELTERMEDHDIHRAILVTQNVLTPFAKDAIMEAYPKNII--ENFMETELLVNITKHELVPKHIPLTMEEKQNLLQKY 158
66358302   90 PIRDIVEKMDEHAIQRAILISQNVLTAHAKVAILDAAPKHYI--ESFLENELLVNITKHELVPKHILLSDDEKLQLLDRY 167
84997627   81 PIRELTERMEDHDIHRAILVTQNVLTPFAKDAIMEAYPKNII--ENFMETELLVNITKHELVPKHIPLTMEEKQNLLQKY 158
124514006  81 PLRELTERMEEKSIQRAILVTQNILTPFARDAIKEAAPRHII--ENFLDTELLVNITKHELVPRHIPLTSDEKKNLLQRY 158
156089419  81 PIRELTEKMEDHDIHRAILVTQNVLTPFAKDAILEAAPRNII--ENFLETELLVNITKHELVPKHIPLTADEKQTLLQRY 158
156101473  81 PLRELTEKMDEKSIQRAILVTQNTLTPFARDAIKEAAPRHII--ENFLDTELLVNITKHELVPRHIPLTSDEKRNLLQRY 158
209878710  81 PIRDIVEKMDEHNIQRAILISQNVLTAHAKVAILDAAPKHYI--ESFLENELLVNITRHELVPKHVLLSDEEKSQLLERY 158
66802850   55 QIKKYVDIMKDRQANRAIIVVQQNITPFAKQALAEFSQEKKItlEQFNEAELLVNITHHQLVPKHILLTKEEKLELLTRY 134
237834761  81 PIRELTERMEERNIQRAILVTQNVLTAFARDAISEAAPRHII--ENFMESELLVNITKHELVPKHVPLTNDEKQNLLNRY 158
221057466  81 PLRELTEKMDEKSIQRAILVTQNTLTPFARDAIKEAAPRHII--ENFLDTELLVNITKHELVPRHIPLTSDEKRNLLQRY 158
67624263   81 PIRDIVEKMDEHAIQRAILISQNVLTAHAKVAILDAAPKHYI--ESFLENELLVNITKHELVPKHILLSDDEKLQLLDRY 158
71029810  159 KVKESQIPRIQSADPVARYFGLSKGQVVKIIRPSETAGRYVTFRLVV 205
66358302  168 KIKETQLPRIQYADPVARYFGLAKGQVVKIIRPSETAGRYVTYRLVV 214
84997627  159 KVKESQIPRIQSADPVARYFGLSKGQVVKIIRPSETAGRYVTFRLVV 205
124514006 159 KIMENKLPRIQDVDPVCRYFGLSKGQVVKIIRPSETAGRYVTYRLVV 205
156089419 159 KVKESQIPRIQAADPVARYFGLTKGQVVKIIRPSETAGRYVTFRLVY 205
156101473 159 KIKENKLPRIQDVDPVCRYFGLAKGQVVKIIRPSETAGRYVTYRLVV 205
209878710 159 KVKETQLPRIQHADPVARYFGLAKSQVVKIIRPSETAGRYVTYRLVV 205
66802850  135 KMKESQLPRIQTNDPVARYYGLSRGHVVKIVRPSETAGRYITYRLCV 181
237834761 159 RVKEIQLPRIQSADPVARYFGLSRGQVVKIIRPSETAGRYVTYRLVV 205
221057466 159 KIKENKLPRIQDVDPVCRYFGLAKGQVVKIIRPSETAGRYVTYRLVV 205
67624263  159 KIKETQLPRIQYADPVARYFGLAKGQVVKIIRPSETAGRYVTYRLVV 205
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap