Conserved Protein Domain Family
PTZ00057

?
PTZ00057: PTZ00057 
glutathione s-transferase; Provisional
Statistics
?
PSSM-Id: 173353
View PSSM: PTZ00057
Aligned: 3 rows
Threshold Bit Score: 339.651
Threshold Setting Gi: 221060344
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124808609   1 MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLS 80 
156102146   1 MAEEIVLYYFDARGKAELIRLIFAYLGIQYTDKRFGENGDAFIEFKNFKKEKETPFNQVPILEMDNIIFAQSQAIVRYLS 80 
221060344   1 MAEEIVLYYFDARGKAELIRLIFAYLGIKYTDKRFGEKGDAFIEFKNFKKEKKTPFEQVPILEMDNIIFAQSQAIVRYLS 80 
124808609  81 KKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNnnndkyYFVGNNLTY 160
156102146  81 KKYKISGNSELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEELPKWSGYFENILKKNNCN------YFVGDDLTY 154
221060344  81 KKYKIGGDTDLDEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEELPKWSGYFENILKKNKCH------YFVGDNLTY 154
124808609 161 ADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY 211
156102146 155 ADLAVFNLYDDIETKYPNSLKNFPLLKAHNEFISNLPNIKNYISNRKESVY 205
221060344 155 ADLAVFNLYDDIETKYPNSLKNFPLLKAHNEFISNLPNIKNYISNRKESVY 205
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap