Conserved Protein Domain Family
PTZ00051

?
PTZ00051: PTZ00051 
thioredoxin; Provisional
Statistics
?
PSSM-Id: 173347
View PSSM: PTZ00051
Aligned: 6 rows
Threshold Bit Score: 160.812
Threshold Setting Gi: 237841781
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
84996335    1 MVHEVTSKEEFDKTLSGDSVVVVDFYANWCGmflyinfnkllvtvllgPCMRFAPQFEELAK--EHPNLVFVKVNVDNLQ 78 
71028418    1 MVHEVTSKEEFEKTLSGDSVVVVDFYADWCG-----------------PCMRFAPQFDALAT--EHPSLLFVKVNVDKLQ 61 
124809933   1 MVKIVTSQAEFDSIISQNELVIVDFFAEWCG-----------------PCKRIAPFYEECSK--TYTKMVFIKVDVDEVS 61 
156100175   1 MVKIVGSQADFEAVLSQNELVIVDFFAEWCG-----------------PCKRIAPFYEECSK--KYTKMVFIKVDVDEVS 61 
237841781   2 PVHHVTTEAQFKSLIEENEMVLVDFYAVWCG-----------------PCRQVAPLVEAMSEkpEYAKVKFVKIDVDELA 64 
221059307   1 MVKIVGSQADFEAILSQNELVIVDFFAEWCG-----------------PCKRIAPFYEECSK--KYTKMVFIKVDVDEVS 61 
84996335   79 ELAQKYNVTSLPTFKVFKSGQVQGEFLGANKDGLKFV 115
71028418   62 ELAQKYNVTSLPTFKVFKSGQVLGEFLGASKEGLKNT 98 
124809933  62 EVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQL 98 
156100175  62 EVTEKENITSMPTFKVYKNGSAVETLLGANDTALKQL 98 
237841781  65 DVAEREEINAMPTFKLFKQGKAVDTVLGANAERVEEM 101
221059307  62 EVTEKENITSMPTFKVYKNGSVVDTLLGANDTALKQL 98 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap