Conserved Protein Domain Family
PTZ00039

?
PTZ00039: PTZ00039 
40S ribosomal protein S20; Provisional
Statistics
?
PSSM-Id: 173336
View PSSM: PTZ00039
Aligned: 10 rows
Threshold Bit Score: 188.484
Threshold Setting Gi: 66816703
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
84996235    1 MDKDTKVGEYDEDNRIHKIRLTLVSRDLKSIEKACRDIINGAKEKNLRVIGPVRMPVRKLKLTTRKSPCGEvnvvlGTNT 80 
71028308    2 DKDSKVPGEYDEDNRIHKIRLTLVSRDLKSIEKACRDIITGAKEKNLRVIGPVRMPVRKLKLTTRKSPCGE-----GTNT 76 
66363366   18 DKQFGQFNGEQQQAPLHKIRITLSSKNLKSIERVCADLIQSAKQKDLKVTGPVRMPVKTLRITTRKSPCGE-----GSKT 92 
66816703    3 MNPIKKTEETVAAPAVNKISITLTSRNPKSLEKVCADIITLAKNKKVKAKGPIRIPNKVLKITTRKSPCGE-----GTNT 77 
124801981   1 MSKLMKGAIDNEKYRLRRIRIALTSKNLRAIEKVCSDIMKGAKEKNLNVSGPVRLPVKTLRITTRKSPCGE-----GTNT 75 
156096619   1 MSKLMKGAVESEKFRLRRIRIALTSKSLRAIEKVCSDIMKGAKEKNLNVSGPVRLPVKTLRITTRKSPCGE-----GTNT 75 
156084884   6 AKDIKSAGDRENVNRIHKIHVTLTSMNLKAIEKACKTMINGAKEKDLKVVGPVRMPVRTLKITTRKSPVGE-----GTNT 80 
209878141   9 SEKQFGQFAGEQQLPQHRIRITLSSKNLKSIERVCSDLIQNAKQKDLRVTGPVRMPVKTLRITTRKSPCGE-----GSKT 83 
221055051   1 MSKLMKGAVESEKFRLRRIRIALTSKSLRAIEKVCSDIMKGAKEKNLNVSGPVRLPVKTLRITTRKSPCGE-----GTNT 75 
67601021   10 DKQFGQFNGEQQQAPLHKIRITLSSKNLKSIERVCADLIQSAKQKDLKVTGPVRMPVKTLRITTRKSPCGE-----GSKT 84 
84996235   81 WDRFEMRIYKRLIDLHSSSAVVRKITSIPLDPGVEVEVSI 120
71028308   77 WDRFEMRIYKRLIDLHSSSAVVRKITSIPLDPGVEVEVSI 116
66363366   93 WDRYEMRIYKRVIDLYSSSDVVKQITSINIDAGVEVEVTI 132
66816703   78 WDRFEMRIHKRVIHILSTQDFVKEMNTISIEAGVDVEVIM 117
124801981  76 WDRFELRIYKRLIDLYSQCEVVTQMTSINIDPVVEVEVII 115
156096619  76 WDRFELRIYKRLIDLYSQCEVVTQMTSINIDPGVEVEVII 115
156084884  81 WDKFEARLYKRVISLHSSSEVVTQITSFPLDPGVEVEVTI 120
209878141  84 WDRYELRIYKRVIDLYSSSDVVRQITSINIDPGVEVEVTI 123
221055051  76 WDRFELRIYKRLIDLYSQCEVVTQMTSINIDPGVEVEVII 115
67601021   85 WDRYEMRIYKRVIDLYSSSDVVKQITSINIDAGVEVEVTI 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap