Conserved Protein Domain Family
PTZ00036

?
PTZ00036: PTZ00036 
glycogen synthase kinase; Provisional
Statistics
?
PSSM-Id: 173333
View PSSM: PTZ00036
Aligned: 2 rows
Threshold Bit Score: 909.414
Threshold Setting Gi: 124504909
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124504909   1 MKNWpidediniyeeknHTNNKNYVNNFEMSDQK-DEEEYSHSSNRSEDEDEERTIDNEINRSPNKSYKLGNIIGNGSFG 79 
221055563   1 MKDW-------------HKAPNGGSGKFPRNGKSlTEMNRSNNNNAGGSGENEKMVESDINRSSSRSYKLGNVVGNGSFG 67 
124504909  80 VVYEAICIDTSEQVAIKKVLQDPQYKNRELMIMKNLNHINIIYLKDYYYTESFKKNEKNIFLNVVMEYIPQTVHKYMKYY 159
221055563  68 VVYEAICLDTSEKVAIKKVLQDPQYKNRELLIMQNLNHVNIIFLKDYYYTECVRKNEKNIFLNVVMEFIPQTVHKYMKHY 147
124504909 160 SRNNQALPMFLVKLYSYQLCRALSYIHSKFICHRDLKPQNLLIDPRTHTLKLCDFGSAKNLLAGQRSVSYICSRFYRAPE 239
221055563 148 ARNNHSLPLLLVKLYSYQLCRALAYLHSKFICHRDLKPQNLLVEPNTHTLKLCDFGSAKNLLGGQRSVSYICSRFYRAPE 227
124504909 240 LMLGSTNYTTHIDLWSLGCIIAEMILGYPIFSGQSSVDQLVRIIQVLGTPTEDQLKEMNPNYADIKFPDVKSKDLRKVFP 319
221055563 228 LMLGATNYTTHIDLWSLGCIIAEMILGYPLFSGQSSVDQLVRIIQVLGTPTEEQMKIMNPNYADVKFPDVKPKDLKKVFP 307
124504909 320 KGTPDEAINLITQFLKYEPLKRLNPIEALADPFFDELRDPCIKLPKYIDKLPELFNFCKEEIQEMSMECRRKIIPKNVYE 399
221055563 308 KGTPEDAINFVSRFLKYEPLKRLSPIEALADPFFDDLRDPCIKLPKYIEKLPDLFNFTDAEIKEMSDACRRKLTSKCTYE 387
124504909 400 ---EFLMVDENDNNIINDTISNDFNESNLDTNNSNNKTHV 436
221055563 388 aykEYLMSKTNEASNMAEKLSKEFGESNIEAKSNRAVNLA 427
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap