Conserved Protein Domain Family
PTZ00033

?
PTZ00033: PTZ00033 
60S ribosomal protein L24; Provisional
Statistics
?
PSSM-Id: 140068
View PSSM: PTZ00033
Aligned: 14 rows
Threshold Bit Score: 140.145
Threshold Setting Gi: 156102655
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71403927    1 MRTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNPRFVPWTRTYRRINRKMTTDRVGRRRAARTV 80 
71666179    1 MRTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNPRFVPWTRTYRRINRKMTTDRVGRRRAARTV 80 
71747474    1 MRTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNPRFIAWTRTYRRIHRKTTTDRVGRRRAARTV 80 
71747470    1 MRTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNPRFIAWTRTYRRIHRKTTTDRVGRRRAARTV 80 
124512926   8 VKTEACSFSEYRIYPGRGQKYIA----RDGKVYFYLSSKFASLALQKKKAAKLRWTQTWRRNNKKTKIETTQRRRYKKTI 83 
146103156   1 MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYMRKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAV 80 
154345610   1 MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYMRKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAV 80 
154345616   1 MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYMRKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAV 80 
157876669   1 MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYMRKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAV 80 
157876676   1 MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYMRKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAV 80 
71403927   81 KVERGIVGADLSYIQEVRAKTKKVDRSAKGKAVRAEMAERKAAKK 125
71666179   81 KVERGIVGADLSYIQEVRAKTKKVDRSAKGKAVRAEMAERKAAKK 125
71747474   81 RAERAIVGAELSYIQEVRAKAKKVDRTAKGKAVREEMAARKAAKK 125
71747470   81 RTERAIVGAELSYIQEVRAKAKKVDRTAKGKAVREEMAARKAAKK 125
124512926  84 KVQKAVCGLTVEDIRNRKAYVQSIEAKNKAKFGTKEKEDKKKTKD 128
146103156  81 RVQRAIVGADLSYIQEVRA-ARKEDRSAKAKAIRAEVAERKAAKK 124
154345610  81 RVQRAIVGADLSYIQEVRA-TRKVDRSAKAKAVRAEVAERKAAKK 124
154345616  81 RVQRAIVGADLSYIQEVRA-TRKVDRSAKAKAVRAEVAERKAAKK 124
157876669  81 RVQRAIVGADLSYIQEVRA-ARKEDRSAKAKAVRAEVAERKAAKK 124
157876676  81 RVQRAIVGADLSYIQEVRA-ARKEDRSAKAKAVRAEVAERKAAKK 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap