Conserved Protein Domain Family
PTZ00031

?
PTZ00031: PTZ00031 
ribosomal protein L2; Provisional
Statistics
?
PSSM-Id: 173329
View PSSM: PTZ00031
Aligned: 6 rows
Threshold Bit Score: 518.629
Threshold Setting Gi: 237840393
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
237840393   1 MSSRSpQSLPEVPRSVRFSSSYLPRAathrnrvafqlfatpreptaskaaaaaraaaeavARSSTVSAPFTV-------- 72 
85000479   11 SSVYA-NLKRIRPEYVDFETNFPKVK----------------------------------IERQLLPVPYTQvrilffyn 55 
124804456  19 SSLYSpNIKKNVPDYIDFETFYPKKE----------------------------------IKPDIM-TAFTM-------- 55 
156086520  17 SSEYG-SVKRNIPLNIDFDTGRYRPP----------------------------------ISKPLLPTPLTQ-------- 53 
156098851   1 --MYSpNVKRNIPEYIDFETFFPKKE----------------------------------IKPDVL-TAFTM-------- 35 
221056390  22 ANMYSpNMKRNIPEYIDFETFFPKKE----------------------------------IKPDVL-TAFTM-------- 58 
237840393  73 QKQQRLLALLAASSSvadpsadlfrvhglpgfsgfrpsspphlskLFRGRVSRHLSCRRVNHLGRNNSGRITVRFRGAGH 152
85000479   56 EKNLRFLKNLETPQT------------------------------LSNCRVVEQLSIRRVKFGGRNNTGRITTRHRGGGH 105
124804456  56 AKQQRLEKLLENNPLv-----------------------------LYKGRVIKKLSCPRIKNSGRNNVGKITVRHRGGGH 106
156086520  54 EANNRILREVGIHEP------------------------------LAKCRVVEQLSIRRVKFGGRNSTGRITTRHRGGGH 103
156098851  36 AKQQRLEKLLENNPLv-----------------------------LYKGRVMKNLSCPRIKNSGRNNVGKITTRHRGGGH 86 
221056390  59 AKQQRLEKLLENNPLv-----------------------------LYKGRVLKKLSCPRIKNSGRNNVGKITTRHRGGGH 109
237840393 153 FRRLRFVDYKRGRKDIFGTVLRLEYDPNRSAHLALLQYDDGVLSYILATEVTRPGDRVVASKHASIAPGNCLPLGNIPVS 232
85000479  106 VQRIRLIDFKRQRKDIFSTVLRIEYDPTRSAHVALIQYDDGVLSYILCAAGVLPGTRLLSSSNAPLLPGNSLPLRHIPVN 185
124804456 107 AQRLRFIDFKRSRKDIYSTVLRIEYDPSRSAHIALIQYEDGVLSYILAPLLLRPGDKIIASKYANINPGNSLPLQNIPVG 186
156086520 104 IQRLRFIDFKRQRKDVPATILRIEYDPTRSAHVALLQYSDGVLSYILCPAGVRPGQILLASASAPIEPGNCLPLRHIPVN 183
156098851  87 VQRLRFIDFKRSRKDIYSTVLRIEYDPSRSAHIALVQYEDGVLSYILAPLLLRPGDKIIASKYANINPGNSLPLKNIPVG 166
221056390 110 VQRLRFIDFKRSRKDIYSTVLRIEYDPSRSAHIALVQYEDGVLSYILAPLLLRPGDKIIASKYANINPGNSLPLKNIPVG 189
237840393 233 TIVHNVELRPGAGGQIVRAGGCYATVVAKDRHFVTLKLSSTEVRRFPADCWATVGQVSNAAHAERIRGKAGVSYWMGERP 312
85000479  186 SIVHNVEMRPGAGGQIARSGGVYCTVTEKDETFATLRLSSTELRKFPLDCWATIGQISNIKHNERILKKAGTRRNMGWRP 265
124804456 187 SIIHNIEMRPGAGGQLIRAAGTYATIISKDNEYATIKLKSTEIRKFPLQCWATIGQVSNLERHMRILGKAGVNRWLGKRP 266
156086520 184 SIVHNVELRPGAGGQIARAGGTYVTIVEKDEMFATLRMASTELRRFPLDCWATLGQVSNIEHNKRILKKAGTRRNLGWRP 263
156098851 167 SIIHNLEMRPGAGGQLIRAAGTYATVLSKDSQYATIKLKSTEIRKFPLECWATIGQVSNLERHMRILGKAGVNRWLGKRP 246
221056390 190 TIIHNLEMRPGAGGQLIRAAGTYATVLSKDNQYATIKLKSTEIRKFPLECWATIGQVSNLERHMRILGKAGVNRWLGKRP 269
237840393 313 RTRGKAMNPVDHPHGGGTGKKGLKRPPVSKWGILCKGYKTRAKKKPLGLIVRRKKANKLIKKFGELGA 380
85000479  266 VVRGIAMNANSHPHGGGNDKSGTKRPKCSIWGICKDGYKTRSKHKPLGFIIRRKLCGRLMKKYGITKR 333
124804456 267 VVRGVAMNPSKHPHGGGTSKKHTKRPKCSLWGICRDGYKTRSKKKPLGLIIRRNICGRLQKKYGVKS- 333
156086520 264 SVRGIAMNPNAHPHGGGNNKSGTKRPKCSVWGVCRSGLKTRSKQKHLGFIVKRKLCGRLMKKYGISKN 331
156098851 247 VVRGVAMNPSKHPHGGGTSKKHTKRPKCSLWGKCRDGFKTRSKKKPLGLIIRRNICGRLQKKYGVTV- 313
221056390 270 VVRGVAMNPSKHPHGGGTSKKHTKRPKCSLWGKCRDGFKTRSKKKPLGLIIRRNICGRLQKKYGVTA- 336
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap