Conserved Protein Domain Family
PTZ00023

?
PTZ00023: PTZ00023 
glyceraldehyde-3-phosphate dehydrogenase; Provisional
Statistics
?
PSSM-Id: 173322
View PSSM: PTZ00023
Aligned: 6 rows
Threshold Bit Score: 615.306
Threshold Setting Gi: 84996653
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
237838193   1 MVCKLGINGFGRIGRLVFRAAMERGDVEVLAINDPFMSLDYMVYLLRYDSVHGHYPGEVSHKDGKLIVGGKAVTVFNEKE 80 
71028750    1 MVVRIGINGYGRIGRLVHRASLSMENVEVVHVNDPFMTPDYIKYLFKHDSVHGSLPYELSVTSEHLMVGSKKVHLTFEKD 80 
124810131   2 AVTKLGINGFGRIGRLVFRAAFGRKDIEVVAINDPFMDLNHLCYLLKYDSVHGQFPCEVTHADGFLLIGEKKVSVFAEKD 81 
84996653    1 MVVRIGINGYGRIGRLVHRASLALENVEVVHVNDPFMTPDYIKYLFKHDSVHGSLPAELSVTSDHLMVGSKKVHLTFEKD 80 
156084588   1 MVVKVGINGFGRIGRLVLRASLAYDNLEVVAINDPFMTADYMAYLLKYDSVHGTLGETVSVTADTLKIGSRSIKLFFERE 80 
221059187   2 AATKLGINGFGRIGRLVFRSAYERNDVEVVAVNDPFMDIKHLCYLLKYDSVHGVFPAEVTPGDGFFTIGNKKIFVHHEKD 81 
237838193  81 PTAIPWGQAGVHYICESTGIFLTKEKAQAHLTNGAKKVIMSAPPKDDTPMFVMGVNNDQYKSSDVIVSNASCTTNCLAPL 160
71028750   81 PAAIPWGKNDVDVVAECSGVFTSTEKAKLHLEGGAKLVVISAPTSDSTPMYVFGVNHTTYDKSVRVMSNASCTTNCLAPL 160
124810131  82 PSQIPWGKCQVDVVCESTGVFLTKELASSHLKGGAKKVIMSAPPKDDTPIYVMGINHHQYDTKQLIVSNASCTTNCLAPL 161
84996653   81 PAAIPWGKNDVDVVAECSGVFTSTEKAKLHLDGGAKLVVISAPTSDSTPMYVFGVNHTSYDKSVRVMSNASCTTNCLAPL 160
156084588  81 PSQIPWGQNGVDFVAECTGVFTSSEKSQQHIAGGAKLVIISAPPSDSTPIYVYGVNHTKYEKSQRIVSNASCTTNCLAPL 160
221059187  82 PANIPWGKYGIDVVCESTGVFLTKELSSAHLKGGAKKVIMSAPPKDDTPIYVMGINHDKYDPKQTIVSNASCTTNCLAPI 161
237838193 161 AKIVHDKFGIVEGLMTTVHAMTANQLTVDGPSKGGKDWRAGRSAGVNIIPASTGAAKAVGKIIPSLNGKLTGMAFRVPVP 240
71028750  161 AKVVNDNFGIVEGLMTTVHAVTANQLTVDGASRGGKDWRAGRCAGVNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVS 240
124810131 162 AKVINDRFGIVEGLMTTVHASTANQLVVDGPSKGGKDWRAGRCALSNIIPASTGAAKAVGKVLPELNGKLTGVAFRVPIG 241
84996653  161 AKVVNDNFGIVEGLMTTVHAVTANQLTVDGASRGGKDWRAGRCAGVNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVS 240
156084588 161 AKVIHEKFGIVEGLMTTVHATTANQLTVDGASRGGKDWRAGRCAGANIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTP 240
221059187 162 AKVLNDKFGIVEGLMTTVHASTANQLVVDGPSKGGKDWRAGRCALTNIIPASTGAAKAVGKVLPELNGKLTGVAFRVPIG 241
237838193 241 DVSVVDLTCKLAKPAKYEDIVAAVKEAAtSGPMKGIISYTDEEVVSSDFVHCKFSSVFDINAGIMLNDTFVKLVSWYDNE 320
71028750  241 DVSVVDLTVKLAKPAKYEDIVRVVKDAA-AGPMKGVLGYTDDEVVSSDFVDDKRSSVFDVKAGISLNDTFVKLVSWYDNE 319
124810131 242 TVSVVDLVCRLQKPAKYEEVALEIKKAA-EGPLKGILGYTEDEVVSQDFVHDNRSSIFDMKAGLALNDNFFKLVSWYDNE 320
84996653  241 DVSVVDLTVRLAKPAKYEDIVKAVKAAA-EGPMKGVLGYTEDEVVSSDFVDDKRSSVFDVKAGISLNDTFVKLVSWYDNE 319
156084588 241 DVSVVDLTCKLAKPATYDEIVSAVKAAS-EGELKGILGWADDDLVSTDFVHDKRSSIFDVKAGIALTDTFVKLVSWYDNE 319
221059187 242 TVSVVDLVCRLEKPAKYEEIAAHMKKAA-EGPLKGILGYTEDEVVSQDFVHDKRSSIFDMKAGLALNDNFFKIVSWYDNE 320
237838193 321 WGYSNRLVELAHYMSVQD 338
71028750  320 WGYSNRLLDLAHYVFQKY 337
124810131 321 WGYSNRVLDLAVHITNN- 337
84996653  320 WGYSNRLLDLAYYVFQKY 337
156084588 320 WGFSNRLLDLGLYICSKQ 337
221059187 321 WGYSNRVLDLAIHITKH- 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap