Conserved Protein Domain Family
PTZ00013

?
PTZ00013: PTZ00013 
plasmepsin 4 (PM4); Provisional
Statistics
?
PSSM-Id: 140051
View PSSM: PTZ00013
Aligned: 3 rows
Threshold Bit Score: 878.551
Threshold Setting Gi: 221060540
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156102356   1 MDIAVKEQDYSNGLIKNSAAFENLKFSNIKNFKVQKRFQILYYILFVFVTGIFFFFLISTYFftPNYKVNKIVQNTEHLT 80 
124808170   1 MALTVKEEEFSNTLIKNASAFDRLKLGNLKNLKIQKKLQFLYLILFVLITGVFFFFLIGNFY--SHRKLYQVIKNTKHTT 78 
221060540   1 MDIAVKEQDYSNGLIKNSAAFENLKFSNIKNFKVQKRFQILYFILFVFVTGIFFFFLISTYFfsPNYNVNKIVQNTEHLT 80 
156102356  81 LAFKIERPYDKVLKTISKKNLKNYIKETFNFFKSGYMKQNYLGSENDVIELDDVANIMFYGEGEVGDNHQKFMLIFDTGS 160
124808170  79 IGFKIDRPHDKVLSSVLKNKLSTYVKESFKFFKSGYAQKGYLGSENDSIELDDVANLMFYGEGQIGTNKQPFMFIFDTGS 158
221060540  81 LAFKIERPYDKVLKTISKKNLKNYVKETYNFFKSGYMKQNYLGSENDVIELDDVANIMFYGEGEVGDNHQKFTLIFDTGS 160
156102356 161 ANLWVPSKKCNSSGCSIKNLYDSSKSKSYEKDGTKVDITYGSGTVKGFFSKDLVTLGHLSMPYKFIEVTDTDDLEPIYSS 240
124808170 159 ANLWVPSVNCDSIGCSTKHLYDASASKSYEKDGTKVEISYGSGTVRGYFSKDVISLGDLSLPYKFIEVTDADDLEPIYSG 238
221060540 161 ANLWVPSKKCTSLGCHIKNLYDSSKSKTYEKDGTKVDITYGSGTVKGFFSKDLVTLGHLSMPYKFIEVTDTDELEPIYSS 240
156102356 241 VEFDGILGLGWKDLSIGSIDPIVVELKNQNKIDNALFTFYLPVHDVHAGYLTIGGIEEKFYEGNITYEKLNHDLYWQIDL 320
124808170 239 SEFDGILGLGWKDLSIGSIDPVVVELKKQNKIDNALFTFYLPVHDKHVGYLTIGGIESDFYEGPLTYEKLNHDLYWQIDL 318
221060540 241 TEFDGILGLGWKDLSIGSIDPIVVELKNQNKIDNALFTFYLPIHDVHAGYLTIGGIEEKFYEGNITYEKLNHDLYWQIDL 320
156102356 321 DVHFGKQTMEKANVIVDSGTTTITAPSEFLNKFFANLNVIKVPFLPFYVTTCDNKEMPTLEFKSANNTYTLEPEYYMNPI 400
124808170 319 DIHFGKYVMQKANAVVDSGTSTITAPTSFLNKFFRDMNVIKVPFLPLYVTTCDNDDLPTLEFHSRNNKYTLEPEFYMDPL 398
221060540 321 DVHFGKQTMQKANVIVDSGTTTITAPSEFLNKFFANLNVIKVPFLPFYVTTCDNKEMPTLEFKSANNTYTLEPEYYMNPL 400
156102356 401 LEVDDTLCMITMLPVDIDSNTFILGDPFMRKYFTVFDYDKESVGFAIAKN 450
124808170 399 SDIDPALCMLYILPVDIDDNTFILGDPFMRKYFTVFDYEKESVGFAVAKN 448
221060540 401 LDVDDTLCMITMLPVDIDTNTFILGDPFMRKYFTVFDYDNESVGFAIAKN 450
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap