Conserved Protein Domain Family
PTZ00005

?
PTZ00005: PTZ00005 
phosphoglycerate kinase; Provisional
Statistics
?
PSSM-Id: 173310
View PSSM: PTZ00005
Aligned: 17 rows
Threshold Bit Score: 694.892
Threshold Setting Gi: 159113544
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66806815    5 KIGNKLSLDKVD--VKGKRVLIRVDYNVPLdKNNNITSTQRIDASIPTLEYCLKNGAKSIVLMSHLGRPDGLVKPEYSLK 82 
71033689    4 LLSSKLGLNDVAdkLPGKRVLMRVDYNVPM-RDGVIKDLTRVKATIPTIKFLLENGVHSVVLMSHCGRPNGRKVPRHSLC 82 
66362626    1 --------------LKGKRVFIRVDMNVPV-KNGQVTDKTRIIASLPTIKYALECGAKSVVLASHLGRPDGQRKMEYSLT 65 
84998174    4 LLSSKLGLKDVAdkLPGKRVLMRVDYNVPL-KSGVVKDLTRVKATIPTIKFLLENDVHSVILMSHCGRPDGRVVDKLSLK 82 
156086640   4 MLSSKLGLADIVdkLPGARILLRADFNVPI-KEGVIGDCTRIKATIPTIEFLLKHNVKSIVMMSHLGRPDGSRVEKYSLR 82 
167521922   1 --MNKLTIDSVD--LKGKRVLMRVDFNVPFdKQGNITNNQRIVGALDSIQYALKQGAKSVVLMSHLGRPDGRVQDKYSMR 76 
209879620   2 DLSKKLSIKDIVseLRDKRIFIRVDFNVPI-KNGVVSDKTRIVASIPTIKFALNHGAKSVVLASHLGRPDGQRKEAFSLK 80 
145543679   1 MLSSKAGIDHVLrqFTNKRVLIRVDFNVPI-KEGKVKNATRIQGAIPTLKKILEQNPKNVTLMSHMGRPDGKRVEKDSLK 79 
118385141   1 MLSRKIGIDHILkhIENKRVLMRVDFNVPL-KEGKVKDPTRIQGSVPSIKKILEQNPKGLVLMSHLGRPDGNRVEKHSMK 79 
67605256    1 -------------------------MNVPV-KNGQVTDKTRIIASLPTIKYALECGAKSVVLASHLGRPDGQRKMEYSLT 54 
66806815   83 PVVKVLEDQLKRPIKFLSDCVGEQVEKECANPEEGTVILLENLRFHIEEEGSGvdaegKKVKANPEKVKEFRESLTKLGD 162
71033689   83 PVVGPLSSLLGMQVKFLNDCVGPEVEKECSNPTKGSVILLENLRFHPEEEGEL-----DGAKVDDVRVQRFRESLTKLGD 157
66362626   66 VIVPILEELLGKSVIFAKDCVGNETEELCKNPAEGSIILLENLRFHLAEEGKGvnengEKVKATPEEIEAFRKSLSSLGD 145
84998174   83 QVVGPLSSLLGMEVNFLSDCVGPEVEKTCSNLTKGSVVLLENLRFHPEEEGEL-----DGQKLSDEKIQKFRDSLTKLGD 157
156086640  83 PVATELSKILNKKVDFLDDCVGETVEKFCQEAPTGTIVLLENLRFHAAEEGVK-----DKVKVDDSIIQAFRNSLTKLGD 157
167521922  77 PVQAELEKLLEKKVTFVSDCVGDEAERVCADPEEGSVILLENLRFHIEEEGKGvdadgNKVKAGDDEVKAFRASLTKLGD 156
209879620  81 PLSPILEELLGCKVEFLSDCVGPEVEAACANPKQGSVILLENLRFHIEEEGKGvnsqgEKIKATAEQVEKFRASLSKLGD 160
145543679  80 IVVPKLEELLGTKINFVNDCVGSEAVE-ASNAGNGQINLLENLRFHIQEEGKGldangAKIKADKESVKKFRKELSSLGD 158
118385141  80 PVVPKLEELLGTKVTFLNDCVGKDVEEAVKSSRNGEIILLENLRFHPEEEGKYidaagNKVKADSKAVKEFRKSLTSLGD 159
67605256   55 VIVPILEELLGKSVIFAKDCVGKETEELCKNPAEGSVILLENLRFHLAEEGKGvnengEKVKATPEEIEAFRKSLSSLGD 134
66806815  163 VYVNDAFGTAHRAHSSMVGINLPQKAAGFLMKKELEYFAKALESPSKPFLAILGGAKVSDKIKLIENLLYKVDEMIIGGG 242
71033689  158 VYVNDAFGTAHRAHSSMVGVNLPLRVAGFLMKKELDYFAKALENPQKPFLAILGGAKVKDKVKLILALLEKIDVLIIGGG 237
66362626  146 IYVNDAFGTAHRAHSSMVGVDLTPKVAGLLLKKELEYFSKALESPTRPFLAIMGGAKVADKIQLIKNLLLKVDRMIIGGG 225
84998174  158 VYVNDAFGTAHRAHSSIVGVNLPLRVAGFLMKKELDYFSKALENPQRPFLAILGGAKVKDKVKLILALLEKIDVLIIGGG 237
156086640 158 IYVNDAFGTAHRAHSSMVGVNVPIKVAGLLMKKELDYFAKILETPKRPFMSILGGAKVKDKIQLIKSIMRKVDILFIGGG 237
167521922 157 IYVNDAFGTAHRAHSSMVGVDLPQKVAGFLVKKELEYFAKALDNPEKPFLAILGGAKVQDKIQLIENLLDKVDEMIIGGG 236
209879620 161 IYVNDAFGTAHRAHSSMVGVNLPHKVAGLLLQKELEYFGKALENPNRPFLAILGGAKVSDKIQLIKNLLSKVNMMIIAGG 240
145543679 159 IYVNDAFGTAHRAHSSMVGIDHKVRVAGYLMKKELDYFARALETPQRPFLVILGGAKVADKIQLIKSMLDKV-------- 230
118385141 160 LFVNDAFGTAHRAHSSMVGVDHKIRAAGYLLKRELDYFSKALESPNRPFLVVLGGAKVKDKIQLIESMLDKVDEMIIGGG 239
67605256  135 IYVNDAFGTAHRAHSSMVGVDLTPKVAGLLLKKELEYFSKALESPTRPFLAIMGGAKVADKIQLIKNLLLKVDRMIIGGG 214
66806815  243 MAFTFKKFIDNKEIGSSLFEKTAEQITKDIIAKAAKNNVKLHFPVDYVIADKFDNDANIKTVTQDQGIPEGWMGLDCGPE 322
71033689  238 MAYTFKKVLDNMPIGTSLFDSDSVHLVKEISEKAKEKGVKLLLPCDFVVTTTFSNDGPIKLASETQGVPDGWMGLDCGPK 317
66362626  226 MAFTFKKVMDNMQIGKSLFDEEGAKIVKEIMDTAKERNVQILLPSDFVIADNFSNEANARIIKDSEGIPDGWMGLDIGPE 305
84998174  238 MAYTFKKVLDGMPIGKSLFDSDSVDLVKEIVEKAKEKGVKFLLPCDFVVTTMFSNDGPIKLASETEGVPEGWMGLDCGPR 317
156086640 238 MAYTFKNVLNGMPIGQSLYDEEGAKIVPDIMAEAKQLGVKVYLPIDFKAATAFSNDAPFKVVSEADGISDDSQGLDCGPK 317
167521922 237 MAFTFKKVLNDVKIGSSLFDAEGANLCERIMKKAEERNVKIHLPTDYVVADKFDAEAASDKATDESGIPDGWMGLDIGEK 316
209879620 241 MAFTFKKVIDEMQIGESLYDEEGAKIVKDIIETAAIRKVQIILPQDFVIADSFSADASARVVKDSEGIPEGWRGLDIGPE 320
145543679 231 WPLHSLKKYTMFPLEKSLFDEEGYKIVDEILAKAKERNVKIHLPTDFVCGTGLDASSPVALHDLKSGIPDGWLGLDAGQL 310
118385141 240 MAFTFLKKIHNIEIGNSLFDEEGYKIVDQLLEKAKAKNVKIHLPVDFLCGDSLEANANTRSFDLKSGIPAGWIGLDAGPK 319
67605256  215 MAFTFKKVMDNMEIGKSLFDEEGAKIVKEIMDTAKERNVQILLPSDFVIADNFSTEANARIIKDSEGIPDGWMGLDIGPE 294
66806815  323 TIKENRDTISRAKTIVWNGPMGVFEKSNFEAGTKAAMDDVVNATTNGAITIIGGGDTATCAAKYNTEDKVSHVSTGGGAS 402
71033689  318 SVEKFSEPVLTAKTIVWNGPLGVFELPNFSKGSNEVLDLVVKATEKGATSIIGGGDTASLAESTGKAPKLSHVSTGGGAS 397
66362626  306 SSNSFKELILSSKTIVANGPPGVFEMEKFSKGSRSMVEALVAATESGSITIVGGGDTASLVEKCGSANKVSHVSTGGGAS 385
84998174  318 SIQKFEESVLTAKTIVWNGPLGVFEFPNFSKGSNEVLDFVVKATENGATTIIGGGDTASLAESTGKASKLSHVSTGGGAS 397
156086640 318 TVELLKTVIEGCQTIVWNGPLGVFEFSNFATGSIAALDIVGEATKRGAISVIGGGDTASLAEQTGRAHLFSHVSTGGGAS 397
167521922 317 SSAAFADAVKRAKVVVWNGPMGVFEFDKFANGTKAVMDACVSATSNGSTVIIGGGDTATCALKFGTEDKVSHVSTGGGAS 396
209879620 321 TSNICKEAILSAKTIVANGPPGVFEMDKFSKGSRSLVEALVAATQAGSITIVGGGDTASLVEKCGTSSKVSHVSTGGGAS 400
145543679 311 TQRENAEAIGRAKTIVWNGPQGAFEIEQFKNGSVSMLNALVKQTQSGATTIVGGGDTVNLVGANKANDKLSHVSTGGGAS 390
118385141 320 TMAENAEAVARANTIVWNGPQGRFEVDKFKVGSSDLLKHVATRTSQGATSIIGGGDTVNLVQQEKATQKVSHVSTGGGAS 399
67605256  295 SSNSFKELILSSKTIVANGPPGVFEMEKFSKGSRSMVEALVAATESGSITIVGGGDTASLVEKCGSANKVSHVSTGGGAS 374
66806815  403 LELLEGKELPGVTALSDL 420
71033689  398 LELLEGKQLPGVVYLTNR 415
66362626  386 LELLEGKLLPGVTSLSSK 403
84998174  398 LELLEGKQLPGVVCLTNK 415
156086640 398 LELMEGKVLPGVDALSSK 415
167521922 397 LELLEGKTLPGIAALSQA 414
209879620 401 LELLEGKLLPGVVALSNK 418
145543679 391 LELLEGKILPGVEYLTNI 408
118385141 400 LELLEGKVLPGVAYLTDI 417
67605256  375 LELLEGKLLPGVTSLSSK 392
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap