Conserved Protein Domain Family
PRK14844

?
PRK14844: PRK14844 
DNA-directed RNA polymerase subunit beta/beta'
Links
?
Statistics
?
PSSM-Id: 173305
View PSSM: PRK14844
Aligned: 4 rows
Threshold Bit Score: 5918.14
Threshold Setting Gi: 58584904
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
58584904     1 MVDSSYMCASNAFIPRISYSRSIDLKDSLLDLVKVQKESYKSFTPGNHGNERLESIFRSVFPINDPLHRATIEFISCRID 80  
42519942     1 MVDSSYMYASGAFVPRVSYSRSIDLKDSLLDLVKVQKESYDSFTPKNKGNERLEVIFHTIFPINDPLRRATIEFISCRVD 80  
190570968    1 MVDSSYMCASSAFVPRVSYSRSIDLKDSLLDLVKVQKGSYNSFTPNNESNERLEAIFHTIFPISDPLHRATIEFLNCRVD 80  
225629893    1 MVDSSYMYASGAFVPRVSYSRSIDLKDSLLDLVKVQKESYDSFTPKNKGNERLEVIFHTIFPINDPLRRATIEFISCRVD 80  
58584904    81 NPKYDESECIKRGITFSARVIASIRLVIMQDGISLDEYKSIKGSGDHSKLSTIIKFIGEQEVHFCELPMMTDKGTFIING 160 
42519942    81 DPKYDESECIKRGVTFSAQVIASIRLVVMQDGISLDEYKSIKESGDHSKLATVVKSIEEQKVHFCGLPMMTDKGTFIING 160 
190570968   81 DLKYSESECIKRGITFSAQVIASIRLVIMQDGVSLEKYQEIKEDDDHSKLATVIKSAEEQEVRFCELPMMTDKGTFIING 160 
225629893   81 DPKYDESECIKRGVTFSAQVIASIRLVVMQDGISLDEYKSIKESGDHSKLATVVKSIEEQKVHFCGLPMMTDKGTFIING 160 
58584904   161 VEKVIVSQMHRSPGVFFDSDKGKTYNSGKLIYSARVIPYRGSWLDIEFDVKDLLYFRIDRKRKLPISVLLKALGLSNSDI 240 
42519942   161 VEKVIVSQMHRSPGVFFDSDKGKTYNSGKLIYSARIIPYRGSWLDIEFDVKDHLYFRVDRKRKLPISVLLKALGLSNNDI 240 
190570968  161 VEKVIVSQMHRSPGVFFDSDRGKTYNSGKLIYSARVIPYRGSWLDIEFDVKDHLYFHIDRKRKLPISVLLKALGLSNNDI 240 
225629893  161 VEKVIVSQMHRSPGVFFDSDKGKTYNSGKLIYSARIIPYRGSWLDIEFDVKDHLYFRVDRKRKLPISVLLKALGLSNNDI 240 
58584904   241 LDRFYEKIKYIKYKNSWKVPFVPDKFKGVRLPFDLMDVEGNVLFKANVRITSRLAKKLHDDELKEYLVPFDSICGLFLAE 320 
42519942   241 LDRFYEKIKYVKHKDGWKVPFVPDKFKGVRLPFDLMDIEGNVLLKANVRITSRLAKKLYDNELKEYLVPFNSICGLFLAE 320 
190570968  241 LNKFYEKIEYIKHKSGWRVPFSPDKFKGVRLPFDLKNVEGNVLLKANVRITSKLAKNLYDNGLKEYLIPYDSICGLFLAE 320 
225629893  241 LDRFYEKIKYVKHKDGWKVPFVPDKFKGVRLPFDLMDIEGNVLLKANVRITSRLAKKLYDNELKEYLVPFNSICGLFLAE 320 
58584904   321 DLIDSVSSTKILSAGESIKIEDVKKLELLSIGEISVLNIDNLSVGPYILNTLFLDENMSYQDALYEIYKVLRPGEVPVLE 400 
42519942   321 DLMDSASSTKILSAGESIKLEDIKKLELLSVDEISVLNIDNLFVGPYILNTLFLDENMSYQDALYEIYRVLRPGEVPVLE 400 
190570968  321 DLIDSASSTKVLSAGESIKLEDIKKLELLSIDKISVLNIDNVSVGPYILNTLFLDENMSYENALYEIYKVLRPGEVPILK 400 
225629893  321 DLMDSASSTKILSAGESIKLEDIKKLELLSVDEISVLNIDNLFVGPYILNTLFLDENMSYQDALYEIYRVLRPGEVPVLE 400 
58584904   401 IVEEFFHNLFFNPEYYDLSNIGRLKLNSYLGLDYDEDLTVLTHEDIIEIVRKIVLLRDGQGSVDDIDHLGNRRVRSVGEF 480 
42519942   401 IVEEFFRNLFFSPEYYDLSNIGRLKLNSYLGLNYDEDLTVLTHEDIIEIVKKIVLLRDGQGSVDDIDHLGNRRVRSVGEF 480 
190570968  401 IVEEFFRNLFFSSEYYDLSNIGRLKLNSCLGLNYEENLTTLTHEDIIEIIRKIVLLRDGQGSVDDIDHLANRRVRSVGEF 480 
225629893  401 IVEEFFRNLFFSPEYYDLSNIGRLKLNSYLGLNYDEDLTVLTHEDIIEIVKKIVLLRDGQGSVDDIDHLGNRRVRSVGEF 480 
58584904   481 IENQFRAGLLKLERAVIDSMSTSSLDKVSSPDFINPKVLTNVLRDFFNSSQLSQFMDQTNPLSEITHKRRLSALGPGGLT 560 
42519942   481 IENQFRTGLLKLERAIVDSMSTSSLDKVSPSDFINPKVLTNVLRDFFNSSQLSQFMDQTNPLSEITHKRRLSALGPGGLT 560 
190570968  481 IENQFRTGLLKLGRAVVDSMSTSSLDKVSPSDFINPKVLTNVLRDFFNSSQLSQFMDQTNPLSEITHKRRLSALGPGGLT 560 
225629893  481 IENQFRTGLLKLERAIVDSMSTSSLDKVSPSDFINPKVLTNVLRDFFNSSQLSQFMDQTNPLSEITHKRRLSALGPGGLT 560 
58584904   561 RDRAGFEVRDVHPTHYGRICPIETPEGQNIGLINSLAIYARVNKYGFIESPYRKVINRVATDQIEYLSAIDEGLYYIADA 640 
42519942   561 RERAGFEVRDVHPTHYGRICPIETPEGQNIGLINSLAIYARINKYGFIESPYRKVVNRVVTDQIEYLSAIDEGSHHIADT 640 
190570968  561 RERAGFEVRDVHPTHYGRICPIETPEGQNIGLINSLAIYARINKYGFIESPYRKVVNKVVTDQIEYLSAIDEGLYYIADT 640 
225629893  561 RERAGFEVRDVHPTHYGRICPIETPEGQNIGLINSLAIYARINKYGFIESPYRKVVNRVVTDQIEYLSAIDEGSHHIADT 640 
58584904   641 SAKLDNNNRFIDDMLYCRYAGNFVMVSSDQVSYIDVSPKQVISVAASLIPFLENDDANRALMGSNMQRQAVPLLKPTAPL 720 
42519942   641 SVKLDENNCFVDDMLYCRYAGSFVMVSSDQVSYIDVSPKQVISVAASLIPFLENDDANRALMGSNMQRQAVPLLKPTAPL 720 
190570968  641 SAKLDENNCFVDDMLYCRYAGTFVMVNSNQVSYIDLSPKQVISVAASLIPFLENDDANRALMGSNMQRQAVPLLKPTAPL 720 
225629893  641 SVKLDENNCFVDDMLYCRYAGSFVMVSSDQVSYIDVSPKQVISVAASLIPFLENDDANRALMGSNMQRQAVPLLKPTAPL 720 
58584904   721 VGTGIESFVASGSGAVVLAKRDGIVDSSDSNSIVIRAFDEERVNYLGVDIYHLKKFQRSNHNTCINQKPLVRIGDYVKEG 800 
42519942   721 VATGMESFVASGSGAVVLAKRDGIVDSSDSNSIVIRAFDKERVNYLDVDIYHLRKFQRSNHNTCINQRPLVCVGDYVKKG 800 
190570968  721 VATGMESFVASGSGAVVLAKRGGIVDSSDSNSIVIRAFDKGGINYLDVDIYHLRKFQRSNHNTCINQKPLVHVGDCVKEG 800 
225629893  721 VATGMESFVASGSGAVVLAKRDGIVDSSDSNSIVIRAFDKERVNYLDVDIYHLRKFQRSNHNTCINQRPLVCVGDYVKKG 800 
58584904   801 DVIADGPAINSGELALGQNLLVAFMSWQGYNFEDSIIISSEIVKKDLFTSIHIEEFECVVHDTPLGSEKITRAIPGVNEE 880 
42519942   801 DVIADGPAINSGELALGKNLLVAFMSWQGYNFEDSIIISSEVVKKDLFTSIHIEEFDCVVHDTPLGSEKITRAIPGVNEE 880 
190570968  801 DVIADGPAINNGELALGQNLLVAFMSWQGYNFEDSIIISSEVVKKDLFTSIHIEEFECVVHDTPLGSEKITRAIPGVNEE 880 
225629893  801 DVIADGPAINSGELALGKNLLVAFMSWQGYNFEDSIIISSEVVKKDLFTSIHIEEFDCVVHDTPLGSEKITRAIPGVNEE 880 
58584904   881 NLYHLDNSGIVKIGTRVGPGYILVGKITPKPSLLLPPETKLLMTIFGEKSFDCADSSLYTSPDVEGTVIDVQVFTRRGVE 960 
42519942   881 NLYHLDDSGIVKIGTRVGPGYILVGKVTPKPSLSLPPETKLLMTIFGEKSFDCADSSLYTSPDVEGTVIDVQVFTRRGVE 960 
190570968  881 NLYHLDDSGIVKVGTRVGPGYILVGKVTPKHSLSLPPETKLLMTIFGEKSFDCVDSSLYTSPDIEGIVIDVQVFTRRGEE 960 
225629893  881 NLYHLDDSGIVKIGTRVGPGYILVGKVTPKPSLSLPPETKLLMTIFGEKSFDCADSSLYTSPDVEGTVIDVQVFTRRGVE 960 
58584904   961 ENERALLIKQKEMNDLEKERDYIINVASEYFYDELKKLLVHSCSQDQEKLDAIEREQWWGIGLKNRSISEQVKNLKKDFD 1040
42519942   961 ENERALLIKQKEINDFEEERDYIINVTSEYFYDELKKLLINSGSQDREKFDSIEREQWWGIGLKNQSISEQVKSLKKDFD 1040
190570968  961 ENERAFLIKQKEANDFEKERDHIINVINQYFYDELRKILINSGSQDRESINFIEREGWWDIGLKNQSISKQVESLKKDFD 1040
225629893  961 ENERALLIKQKEINDFEEERDYIINVTSEYFYDELKKLLINSGSQDREKFDSIEREQWWGIGLKNQSISEQVKSLKKDFD 1040
58584904  1041 KKVSNTIAQFKQKVEKLDEGYDLPQGVLMSVKVFIAVKHSLQPGDKMAGRHGNKGVISRVVPVEDMPYLEDGTPVDIILN 1120
42519942  1041 EKVSHAIAQFKRKVEKLHEGYDLPQGVSMSVKVFIAVKHSLQPGDKMAGRHGNKGVISRVVPVEDMPYLEDGTPVDIILN 1120
190570968 1041 EKVSHAIANFKRKVEKLHEGYDLPQGVSMSVKVFIAVKHSLQPGDKMAGRHGNKGVISRVVPVEDMPYLEDGTPIDIILN 1120
225629893 1041 EKVSHAIAQFKRKVEKLHEGYDLPQGVSMSVKVFIAVKHSLQPGDKMAGRHGNKGVISRVVPVEDMPYLEDGTPVDIILN 1120
58584904  1121 PLGVPSRMNVGQILETHVGWACKKLGERVGNILDEINKINSDFCKEIRSLDDNNFAKFAAVYFDNKKTEEVRDDEITDSL 1200
42519942  1121 PLGVPSRMNVGQILETHVGWACRKLGEKVSNILDEINKIKSAFCKGIRSLNDDNFTQFAVAYLDNKKIENIDDDEITASV 1200
190570968 1121 PLGVPSRMNVGQILETHVGWACKKLGEKVGNILDEINKIKRAFCEAIRSLSDDDFEKFAALYLDNKKFEDINDDEITASI 1200
225629893 1121 PLGVPSRMNVGQILETHVGWACRKLGEKVSNILDEINKIKSAFCKGIRSLNDDNFTQFAVAYLDNKKIENIDDDEITASV 1200
58584904  1201 VNIPNKGLLNDELNALVENYLNSCKSAYDNLRSFLIEVYSCGSDVSICNNIRDISNSNLIEFAHKLRNGIPVAAPVFEGP 1280
42519942  1201 LNTPNKNALNDELNELVENYLNSCKSSYSNLRNFLIEVYSYGSNVSICNDIRNISDNNLIEFARKLRDGVPVAAPVFEGP 1280
190570968 1201 LDTPNKDELNNELTTLVENYFNSCKDAHSSLRHFLIEVYSCGSNLSICNNIRDINDNHLIEFAYKLRDGIPVTAPVFEGP 1280
225629893 1201 LNTPNKNALNDELNELVENYLNSCKSSYSNLRNFLIEVYSYGSNVSICNDIRNISDNNLIEFARKLRDGVPVAAPVFEGP 1280
58584904  1281 KDKNIIKLFTLAGLDPSGQTEAYDGRTGEKFDRKVTVGYMYMLKLHHLVDDKIHARSVGPYSLVTQQPLGGKSHFGGQRF 1360
42519942  1281 KDEQIAKLFELAGLDNSGQAVLYDGCSGEKFDRKVTVGYMYMLKLHHLVDGKIHARSVGPYSLVTQQPLGGKSHFGGQRF 1360
190570968 1281 KDEQIVKLFELAGLDNSGQVVLYDGCSGEKFDRKVTVGYMYMLKLHHLVDGKIHARSVGPYSLVTQQPLGGKSHFGGQRF 1360
225629893 1281 KDEQIAKLFELAGLDNSGQAVLYDGCSGEKFDRKVTVGYMYMLKLHHLVDGKIHARSVGPYSLVTQQPLGGKSHFGGQRF 1360
58584904  1361 GEMECWALQAYGAAYTLQEMLTVKSDDINGRVKIYESIIKGDSNFECGTPESFNVMIKELRSLCLNVALKQNNVVIEDIS 1440
42519942  1361 GEMECWALQAYGAAYTLQEMLTVKSDDINGRVKIYESIIKGDSNFECGIPESFNVMIKELRSLCLNVDLKQNDVVIEDIS 1440
190570968 1361 GEMECWALQAYGAAYTLQEMLTVKSDDINGRVKIYESVIKGDSNFECGIPESFNVMIKELRSLCFNVDLKQNDIVIEDIS 1440
225629893 1361 GEMECWALQAYGAAYTLQEMLTVKSDDINGRVKIYESIIKGDSNFECGIPESFNVMIKELRSLCLNVDLKQNDVVIEDIS 1440
58584904  1441 HTNIAQSFDKIGISIASPENIKSMSYGEVKDVSTANYRTFKVEKGGLFCPKIFGPVNDDECLCGKYKKRRHRGRICEKCG 1520
42519942  1441 HTNIAQPFNEVSISIASPESIKRISCGEIEDVLTANYRTFKVEKGGLFCPKVFGPVNDDECLCGKYKKRRHRGRICEKCG 1520
190570968 1441 HTNIAQSFNEVSISIASPESIKRMSYGEITDVSTANYRTFKVEKGGLFCPKIFGPVNDDECLCGKYKKRRHRGRICEKCG 1520
225629893 1441 HTNIAQPFNEVSISIASPESIKRISCGEIEDVSTANYRTFKVEKGGLFCPKVFGPVNDDECLCGKYKKRRHRGRICEKCG 1520
58584904  1521 VEVTSSKVRRERMGHIELASPVAHIWFLKSLPSRIGALLDMSLRDIENILYSDNYIVIDPLVSPFEKGEIISEKIYNEAK 1600
42519942  1521 VEVTSSKVRRERMGHIELASPVAHIWFLKSLPSRIGALLDMSLRDIENILYSDNYIVIDPLVSPFEKGEIISEKAYNEAK 1600
190570968 1521 VEVTSSKVRRERMGHIELASPVAHIWFLKSLPSRIGALLDMSLRDIESILYSDNYVVIDPLVSSFEKGEIISEKAYNEAK 1600
225629893 1521 VEVTSSKVRRERMGHIELASPVAHIWFLKSLPSRIGALLDMSLRDIENILYSDNYIVIDPLVSPFEKGEIISEKAYNEAK 1600
58584904  1601 DDYGIDSFVAMQGVEAIRELLTCLDLHQIRKDLRLELESVASEIRRKKIIKRLRIIENFIKSGNRPEWMILTTIPILPPD 1680
42519942  1601 DSYGIDSFVAMQGVEAIRELLTRLDLHEIRKDLRLELESVASEIRRKKIIKRLRIVENFIKSGNRPEWMILTTIPILPPD 1680
190570968 1601 DSYGVDSFIAMQGVEAIRELLIRLDLHEIRKNLRQELESVASEMRRKKIIKRLRIVENFIKSGNRPEWMILTAIPILPPD 1680
225629893 1601 DSYGIDSFVAMQGVEAIRELLTRLDLHEIRKDLRLELESVASEIRRKKIIKRLRIVENFIKSGNRPEWMILTTIPILPPD 1680
58584904  1681 LRPLVSLESGRPAVSDLNHHYRTIINRNNRLRKLLSLNPPEIMIRNEKRMLQEAVDSLFDNSRRNALTNKAGAIGYKKSI 1760
42519942  1681 LRPLVSLESGRPAVSDLNHHYRTIINRNNRLRKLLSLNPPEIMIRNEKRMLQEAVDSLFDNSRRNTLVNKAGAVGYKKSI 1760
190570968 1681 LRPLVSLESGRPAVSDLNHHYRTIINRNNRLRKLLSLNPPEIMIRNEKRMLQEAVDSLFDNSRRNALVNKAGATGYKKSI 1760
225629893 1681 LRPLVSLESGRPAVSDLNHHYRTIINRNNRLRKLLSLNPPEIMIRNEKRMLQEAVDSLFDNSRRNTLVNKAGAVGYKKSI 1760
58584904  1761 SDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPALKLNQCGLPKRMALELFKPFVYSKLKLYGMAPTIKFASKLIRAEKPE 1840
42519942  1761 SDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPTLKLNQCGLPKRMALELFKPFVYSKLKMYGMAPTIKFASKLIRAEKPE 1840
190570968 1761 SDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPTLKLNQCGLPKRMALELFKPFVYSRLKIYGMAPTIKFASKLIRAEKPE 1840
225629893 1761 SDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPTLKLNQCGLPKRMALELFKPFVYSKLKMYGMAPTIKFASKLIRAEKPE 1840
58584904  1841 VWDMLEEVIKEHPVLLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCTAFNADFDGDQMAVHVPISLEAQLEARVLMMST 1920
42519942  1841 VWDMLEEVIKEHPVLLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCTAFNADFDGDQMAVHVPISLEAQLEARVLMMST 1920
190570968 1841 VWDMLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTAFNADFDGDQMAVHVPISLEAQLEARVLMMSI 1920
225629893 1841 VWDMLEEVIKEHPVLLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCTAFNADFDGDQMAVHVPISLEAQLEARVLMMST 1920
58584904  1921 NNVLSPSNGRPIIVPSKDIILGIYYLTLQEQTDkegDDLPFLGTFGEVEHSLSDGTLHIHSSIKYRIEYTNSEGETCYKT 2000
42519942  1921 NNVLSPSNGRPIIVPSKDIVLGIYYLTLQEPKE---DNLPSFGAFCEVEHSLSDGILHIHSSIKYRMEYINSSGETHYKT 1997
190570968 1921 NNVLSPSNGRPIIVPSKDIVLGIYYLTLQQLKK---DDLPLFCAFCEVEHSLNNGTLHIHSHIKYKMEHINSDGNIQYKT 1997
225629893 1921 NNVLSPSNGRPIIVPSKDIVLGIYYLTLQEPKE---DNLPSFGAFCEVEHSLSDGTLHIHSSIKYRMEYINSSGETHYKT 1997
58584904  2001 IRTTPGRLILWQIFPKHENLNFDLVNQVLTVKEVTSIVDLIYRNCGQSATVEFSDRLMVLGFEYATFSGISFSRCDLVIP 2080
42519942  1998 VCTTPGRLILWQIFPKHENLGFDLINQILTVKEITGIVDLVYRNCGQSATVAFSDKLMVLGFEYATFSGVSFGRCDMVIP 2077
190570968 1998 ICTTPGRLILWQIFPKHENLSFDLINQVLTVKEITSIVDLVYRSCGQSATVVFSDKLMTLGFEYATFSGTSFSRCDMVIP 2077
225629893 1998 VCTTPGRLILWQIFPKHENLGFDLINQILTVKEITGIVDLVYRNCGQSATVAFSDKLMVLGFEYATFSGVSFGRCDMVIP 2077
58584904  2081 ETKAEHVDHARGEIKKFSMQYQDGLITRSERYNKVIDEWSKCTDMIANDMLKSISVYDRNSKYNSVYMMVNSGARGSTSQ 2160
42519942  2078 ETKATHVDHARGEIKKFSMQYQDGLITRSERYNKVIDEWSKCTDMIANDMLKAISIYDGNSKYNSVYMMVNSGARGSTSQ 2157
190570968 2078 ETKATHVDYTRGEIKKFSAQYQDGLITKSERYNKVIDEWSKCTDIIANDMLKAISLYDENSKYNSIYMMVSSGARGSTSQ 2157
225629893 2078 ETKATHVDHARGEIKKFSMQYQDGLITRSERYNKVIDEWSKCTDMIANDMLKAISIYDGNSKYNSVYMMVNSGARGSTSQ 2157
58584904  2161 MKQLAGMRGLMTKPSGEIIETPIISNFREGLNVFEYFNSTHGARKGLADTALKTANSGYLTRRLVDVSQNCIVTKHDCKT 2240
42519942  2158 MKQLAGMRGLMTKPSGEIIETPIISNFREGLNVFEYFNSTHGARKGLADTALKTANSGYLTRRLVDVSQNCIVAKHDCKT 2237
190570968 2158 MKQLAGMRGLMTKPSGEIIETPIISNFREGLNVFEYFNSTHGARKGLADTALKTANSGYLTRRLVDVSQNCIVTKHDCKT 2237
225629893 2158 MKQLAGMRGLMTKPSGEIIETPIISNFREGLNVFEYFNSTHGARKGLADTALKTANSGYLTRRLVDVSQNCIVTKHDCKT 2237
58584904  2241 KNGLVVRATVEGGTIVASLESVVLGRTAANDIYNPVTKELLVKAGELIDEDKVKQINIAGLDAVKIRSPLTCEVSPGVCS 2320
42519942  2238 KNGLVVRATVEGSTIVASLESVVLGRTAANDIYNPVTKELLVKAGELIDEDKVKQISIAGLDVVKIRSPLTCEISPGVCS 2317
190570968 2238 KNGLIVRAIVEGSTIVASLESVVLGRTAANDIYNPVTKELLLKAGQLIDEGKVKQINIAGLDVIKIRSPLTCEISPGVCS 2317
225629893 2238 KNGLVVRATVEGSTIVASLESVVLGRTAANDIYNPVTKELLVKAGELIDEDKVKQISIAGLDVVKIRSPLTCEISPGVCS 2317
58584904  2321 LCYGRDLATGKIVSIGEAVGVIAAQSVGEPGTQLTMRTFHIGGVMTRGVESSNIIASINAKIKLSNSNIIIDKNGDKIAI 2400
42519942  2318 LCYGRDLATGKIVSIGEAVGVIAAQSVGEPGTQLTMRTFHIGGVMTRGVESSNIIASINAKIKLNNSNIIIDRNGNKIVI 2397
190570968 2318 LCYGRDLATGKIVSIGEAVGVIAAQSVGEPGTQLTMRTFHIGGVMTRGVESSNIIASINARIKLNNSNIIIDKNGNKIVI 2397
225629893 2318 LCYGRDLATGKIVSIGEAVGVIAAQSVGEPGTQLTMRTFHIGGVMTRGVESSNIIASINAKIKLNNSNIIIDRNGNKIVI 2397
58584904  2401 SRSCEVVLIDSLGSEKLRHSIPYGAKLCVDEGKSVKIGDKIAEWDPYTLPIITEKTGTVLYQDLKDGVSITEVMDESTGI 2480
42519942  2398 SRSCEVVLIDSLGSEKLKHSVPYGAKLYVDESGSVKIGDKVAEWDPYTLPIITEKTGTVSYQDLKDGISITEVMDESTGI 2477
190570968 2398 SRSCEVVLIDSLGSEKLKHSVPYGAKLYVNEGELVKIGDKVAEWDPYTLPIITEKSGTISYQDLKDGISITEVMDESTGI 2477
225629893 2398 SRSCEVVLIDSLGSEKLKHSVPYGAKLYVDESGSVKIGDKVAEWDPYTLPIITEKTGTVSYQDLKDGISITEVMDESTGI 2477
58584904  2481 SSKVVKDWKLYSGGANLRPRIVLLDDNGKVMTLASGIEACYFIPIGAVLNVQDGQKVHAGDVITRTPRESVKTRDITGGL 2560
42519942  2478 SSKVVKDWKLHSGGANLRPRIVLLDDNGKVMTLASGVEACYFIPIGAVLNVQDGQKVHAGDVITRTPRESVKTRDITGGL 2557
190570968 2478 SNRVVKDWKLYSGVANLRPRIALLDDNEKVITLSSGVEACYFIPVGAVLNVQDGQKVHAGDVITRTPRESVRTRDITGGL 2557
225629893 2478 SSKVVKDWKLHSGGANLRPRIVLLDDNGKVMTLASGVEACYFIPIGAVLNVQDGQKVHAGDVITRTPRESVKTRDITGGL 2557
58584904  2561 PRVIELFEARRPREHAIVSEIDGHVVFSEKDRRGKRSVLIKPLNEQISPIEYLVSRSKHVIVNEGDFVRKGDLLMDGDPD 2640
42519942  2558 PRVIELFEARRPKEHAIVSEIDGYVAFSEKDRRGKRSILIKPVDEQISPVEYLVSRSKHVIVNESDFVRKGDLLMDGDPD 2637
190570968 2558 PKVIELFEARRPKEHAIVSEIDGYVMFSEKDRRGKRSIVIKPVDKQASPVEYLVSRSKHVIVNEGDFVRKGDLLMDGDPD 2637
225629893 2558 PRVIELFEARRPKEHAIVSEIDGYVAFSEKDRRGKRSILIKPVDEQISPVEYLVSRSKHVIVNEGDFVRKGDLLMDGDPD 2637
58584904  2641 LHDILRVLGLEALAHYMISEIQQVYRLQGVRIDNKHLEVILKQMLQKVEITDPGDTMYLVGESIDKLEVDKGNDVMSNSG 2720
42519942  2638 LHDILRVLGLEALAHYMISEIQQVYRLQGVRIDNKHLEVILKQMLQKVEITDPGDTMYLVGESIDKLEVDRENDAMSNSG 2717
190570968 2638 LHDILRVLGLEALAHYMISEIQQVYRLQGVRIDNKHLEVILKQMLQKVEITDPGDTMYLIGENIDRLEIDRENDAMNNSG 2717
225629893 2638 LHDILRVLGLEALAHYMISEIQQVYRLQGVRIDNKHLEVILKQMLQKVEITDPGDTMYLVGESIDKLEVDRENDAMSNSG 2717
58584904  2721 KRPACYLPILQGITRASLETKSFISAASFQETTKVLTEAAFCGKEDPLSGLKENVIVGRLIPAGTGLIMSKVRALSLCDN 2800
42519942  2718 KRPTHYLPILQGITRASLETSSFISAASFQETTKVLTEAAFCGKSDPLSGLKENVIVGRLIPAGTGLIMNKIRALSLCDN 2797
190570968 2718 KRPAHYLPILQGITRASLETNSFISAASFQETTKVLTEAAFCGKSDPLSGLKENVIVGRLIPAGTGLIMNKVKTLSLCEN 2797
225629893 2718 KRSTHYLPILQGITRASLETSSFISAASFQETTKVLTEAAFCGKSDPLSGLKENVIVGRLIPAGTGLIMNKIRALSLCDN 2797
58584904  2801 MDKYEKYFDIEAYDEKLLEDNGCHLHSGKKESVAEsrYN 2839
42519942  2798 VDKYEKYFDIETYDEEWLMDNGCHLHSDEEESVVA--YD 2834
190570968 2798 IDKYEKYFDIETYDEKLLSDNSYQLHSDEEESVVAshYD 2836
225629893 2798 VDKYEKYFDIETYDEEWLMDNGCHLHSGEEESVVA--YD 2834
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap