Conserved Protein Domain Family
PRK14842

?
PRK14842: PRK14842 
undecaprenyl pyrophosphate synthase; Provisional
Statistics
?
PSSM-Id: 173303
View PSSM: PRK14842
Aligned: 6 rows
Threshold Bit Score: 474.476
Threshold Setting Gi: 183221972
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
24215993    1 MGLFESNLPKHIAVIMDGNGRWATSRGKSRSEGHREGAQAIDRLMDASLELGLKNISLYAFSTENWKRPVTEIRSIFSLL 80 
45656745    1 MGLFESNLPKHIAVIMDGNGRWATSRGKSRSEGHREGAQAIDRLMDASLELGLKNISLYAFSTENWKRPVTEIRSIFSLL 80 
183221972   1 MKLH--TIPAHIAVIMDGNGRWAENQGKKRTEGHREGANAIDRLLDVALEYKIPNISLYAFSTENWKRPITEIQAIFGLL 78 
189912040   1 MKLH--TIPAHIAVIMDGNGRWAENQGKKRTEGHREGANAIDRLLDVALEYKIPNISLYAFSTENWKRPITEIQAIFGLL 78 
116327677   1 MGLFESKFPQHIAVIMDGNGRWAVSLGKPRSEGHREGANAIDRLMDASLEFGLKNVSLYAFSTENWRRPITEIRSIFNLL 80 
116330592   1 MGLFESKFPQHIAVIMDGNGRWAVSLGKPRSEGHREGANAIDRLMDASLEFGLKNVSLYAFSTENWRRPITEIRSIFNLL 80 
24215993   81 IEFIETRLDTIHKRGIRILHSGSRKKLTRGVLDKIDFAVDKTQKNKNLTVNFCLNYGSRDELLRAAQELFLERKRSKVAL 160
45656745   81 IEFIETRLDTIHKRGIRILHSGSRKKLTRGVLDKIDFAVDKTQKNKNLTVNFCLNYGSRDELLRAAQELFLERKRSKVAL 160
183221972  79 VEFIETRLDTIHAKGIRIHHSGARNKLSKTVLKKIDHAMAVTKKNKKLTANFCLNYGGHEEILSNFSRVMAARKAKKETL 158
189912040  79 VEFIETRLDTIHAKGIRIHHSGARNKLSKTVLKKIDHAMAVTKKNKKLTANFCLNYGGHEEILSNFSRVMAARKAKKETL 158
116327677  81 VEFIDTRLDTIHTRGIRIHHSGSRKRLTRNVLDKIDFAIEKTKKNKNLNVNFCLNYGSKDELLRAAQEAFLRRKKEKVSF 160
116330592  81 VEFIDTRLDTIHTRGIRIHHSGSRKRLTRNVLDKIDFAIEKTKKNKNLNVNFCLNYGSKDELLRAAQEAFLRRKKEKVSF 160
24215993  161 EKPLKEKEFEKFLYTSILPPVDLLIRTAGEQRLSNFLLWQSAYAELYFTDTLWPEFDKNSLVDSLKWYETRTRKFGGLTN 240
45656745  161 EKPLKEKEFEKFLYTSILPPVDLLIRTAGEQRLSNFLLWQSAYAELYFTDTLWPEFDKNSLVDSLKWYETRTRKFGGLTN 240
183221972 159 DKPISPKEFEKYLYTSPLPPVDLLIRTAGEQRISNFLLWQSAYAEMYFTSTLWPDFGRTSLEEALLFFDSRKRKFGGLL- 237
189912040 159 DKPISPKEFEKYLYTSPLPPVDLLIRTAGEQRISNFLLWQSAYAEMYFTSTLWPDFGRTSLEEALLFFDSRKRKFGGLL- 237
116327677 161 EKPLKEKELEKFLYTSTLPPVDLLIRTAGEQRLSNFLLWQSAYAELYFTDTLWPDFDKNSLVDSLKWYETRTRKFGGLEN 240
116330592 161 EKPLKEKELEKFLYTSTLPPVDLLIRTAGEQRLSNFLLWQSAYAELYFTDTLWPDFDKNSLVDSLKWYETRTRKFGGLEN 240
24215993  241 G 241
45656745  241 G 241
183221972     -    
189912040     -    
116327677 241 G 241
116330592 241 G 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap