Conserved Protein Domain Family
PRK14841

?
PRK14841: PRK14841 
undecaprenyl pyrophosphate synthase; Provisional
Statistics
?
PSSM-Id: 173302
View PSSM: PRK14841
Aligned: 5 rows
Threshold Bit Score: 439.811
Threshold Setting Gi: 170289220
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148270515   1 MRIPQHVAIIMDGNGRWAKKRGLPRIKGHQRGAKVLHNTVKWSLEMGIKYLTAFSFSTENWKRPKEEVEFLMDLFVQMID 80 
170289220   1 MRIPQHVAIIMDGNGRWAKKRGLPRIKGHQRGAEVLHNTVKWSLELGIKYLTAFSFSTENWKRPKEEVEFLMDLFVQMID 80 
15644150    1 MRIPQHVAIIMDGNGRWAKKRGLPRIKGHQRGAEVLHNTVKWSLELGIKYLTAFSFSTENWKRPKEEVEFLMDLFVQMID 80 
222100167   1 MRIPQHVAIIMDGNGRWAKKRGLPRIKGHERGAHVLHNTVKWSLELGIKYLTAYSFSTENWKRPKEEVEFLMNLFVQMID 80 
281412822   1 MRIPQHVAIIMDGNGRWAKKRGLPRIKGHQRGAKVLHNTVKWSLEMGIKYLTAFSFSTENWKRPKEEVEFLMDLFVQMID 80 
148270515  81 REMELLRKERVRVRILGRKEGLSEKVLKKWQEVEEKTKEFDRMTLVIAFNYGGRREILDAVESILKDVSQGKKIELTEET 160
170289220  81 REMELLRRERVRVRILGRKEGLPERVLKKWKEVEEKTKEFDRMTLIIAFNYGGRREILDAVESILKDASQGKKIELTEET 160
15644150   81 REMELLRRERVRVRILGRKEGLPEKVLKKWQEVEEKTKEFDRMTLIIAFNYGGRREILDAVEFILKDVSHGKKIELTEET 160
222100167  81 REMDLLRREKVRVRILGRKEGLPESVLRKWNEVEEKTNSFDRMTLVIAFNYGGRREILDAVERILRDVEKEKKIVLNEET 160
281412822  81 REMELLRKERVRVRILGRKEGLSEKVLKKWQEVEEKTKEFDRMTLVIAFNYGGRREILDAVESILKDVSQGKKIELTEET 160
148270515 161 FRQYLYLPDVPDPDLIIRTSGEMRLSNFLLWQSAYSELYFFKKPWPDFTKRDFLRAIESYSKRERRFGGLING 233
170289220 161 FRQYLYLPDVPDPDLIIRTSGEMRLSNFLLWQSAYSELYFFKKLWPDFTKRDFLRAIESYSKRERRFGGLSNG 233
15644150  161 FRQYLYLPDVPDPDLIIRTSGEMRLSNFLLWQSAYSELYFFKKLWPDFTKRDFLRAIESYSKRERRFGGLING 233
222100167 161 FKSYLYLPDVPDPDLIIRTSGELRLSNFLIWQSAYSELYFTRKLWPDFTKRDFLRAIESYSRRERRFGGLGDG 233
281412822 161 FRQYLYLPDVPDPDLIIRTSGEMRLSNFLLWQSAYSELYFFKKPWPDFTKKDFLRAIESYSKRERRFGGLING 233
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap