Conserved Protein Domain Family
PRK14840

?
PRK14840: PRK14840 
undecaprenyl pyrophosphate synthase; Provisional
Statistics
?
PSSM-Id: 173301
View PSSM: PRK14840
Aligned: 14 rows
Threshold Bit Score: 490.511
Threshold Setting Gi: 76789186
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
76789186    1 MSLALEQAtliQENLPQGNSLPRHIAIIMDGNRRWQRKHEQFCQKRAISGHRQGADSIPQIVDTALHLGVEALTLFAFST 80 
89898638    1 MSLTLKQA---DQADPSTQSLPRHVAIIMDGNRRWYQRHQILRSIQHSSGHHYGAKALPDIIESAFSLGIEVLTLFAFST 77 
62184817    1 MSLTLKQA---DQASLSMQSLPKHVAIIMDGNRRWYRQHQAQCSIKSSSGHYYGAKVLPNIIESAFSLGIEVLTLFAFST 77 
29839943    1 MPLTLKQE---DQVNVSLQSLPRHVAIIMDGNRRWHQQHQTQCTLKQTSGHYYGAKALPSIIESAFSLGIEVLTLFAFST 77 
33241919    1 MSLATNNA---ESKFPSLQRLPNHVAIIMDGNRRWYKKHREECGHTHTSGHYYGAKVLPNILNAVLDLGIKVLTLYTFST 77 
15836097    1 MSLATNNA---ESKFPSLQRLPNHVAIIMDGNRRWYKKHREECGHTHTSGHYYGAKVLPNILNAVLDLGIKVLTLYTFST 77 
15618477    1 MSLATNNA---ESKFPSLQRLPNHVAIIMDGNRRWYKKHREECGHTHTSGHYYGAKVLPNILNAVLDLGIKVLTLYTFST 77 
166154664   1 MSLALEQAtliQENLPQGNSLPRHIAIIMDGNRRWQRKHEQFCQKRAISGHRQGADSIPQIVDTALHLGVEALTLFAFST 80 
166155539   1 MSLALEQAtliQENLPQGNSLPRHIAIIMDGNRRWQRKHEQFCQKRAISGHRQGADSIPQIVDTALHLGVEALTLFAFST 80 
237802878   1 MSLALEQAtliQENLPQGNSLPRHIAIIMDGNRRWQRKHEQFCQKRAISGHRQGADSIPQIVDTALHLGVEALTLFAFST 80 
76789186   81 ENFSRSKSEVAELFSLFNSQLRSKLSFLHDREIRLRCIGDLSKLPQELQNNIEQASSATAHYSRMELIFAINYGSKDELV 160
89898638   78 ENFLRSTEEVEELFSLFHSQLDEQLPHLIENKIRLRCIGNLLALPKHLQQQIAKITSQTKEYSGRELVLAINYGGKDELV 157
62184817   78 ENFLRSAEEVAELFSLFHAQLDEQLPYLIENKIRLRCIGNLLALPPDLQQQIAKVASETQRHGMRELVLAINYGGKDELV 157
29839943   78 ENFLRSTEEVEELFSLFHSQLDEQFPYLIENKIRLRCIGNLSALPLQLQQKISEISLKTHQNSHRDLVLAINYGGKDELV 157
33241919   78 ENFGRPKEEIQEIFNIFYTQLDKQLPYLMENEICLRCIGDLSKLPKGIQTKINHVSRMTASFSRLELVLAVNYGGKDELV 157
15836097   78 ENFGRPKEEIQEIFNIFYTQLDKQLPYLMENEICLRCIGDLSKLPKGIQTKINHVSRMTASFSRLELVLAVNYGGKDELV 157
15618477   78 ENFGRPKEEIQEIFNIFYTQLDKQLPYLMENEICLRCIGDLSKLPKGIQTKINHVSRMTASFSRLELVLAVNYGGKDELV 157
166154664  81 ENFSRSKSEVAELFSLFNSQLRSKLSFLHDREIRLRCIGDLSKLPQELQNNIEQASSATAHYSRMELIFAINYGSKDELV 160
166155539  81 ENFSRSKSEVAELFSLFNSQLRSKLSFLHDREIRLRCIGDLSKLPQELQNNIEQASSATAHYSRMELIFAINYGSKDELV 160
237802878  81 ENFSRSKSEVAELFSLFNSQLRSKLSFLHDREIRLRCIGDLSKLPQELQNNIEQASSATAHYSRMELIFAINYGSKDELV 160
76789186  161 RAFKELHQDLASKKISVNDISEELISSYLDTSGLPDPDLLIRTGGEMRVSNFLLWQIAYTELYVTDVLWPDFTANDLLEA 240
89898638  158 RAFKKLHQDLSDQKISLDSVSEGLIRLYLDTSEIPDPDLLIRTGGEMRVSNFLLWQIAYTELYVTDVLWPDFKPDHLLDA 237
62184817  158 RAFKKLHHDLVNKKISLDSVSEELIRLYLDTSEIPDPDLLIRTGGEMRVSNFLLWQIAYTELYVTDVLWPDFKPYHLLDA 237
29839943  158 RAFKKLHQDLVEQKISSDSISEELIRLYLDTSEMPDPDLLIRTGGEMRVSNFLLWQIAYTELYVTDILWPDFKPNHFLDA 237
33241919  158 RAFKKLHVDILNKKISSDDLSESLISSYLDTSGLTDPDLLIRTGGEMRVSNFLLWQIAYTELYITDTLWPDFTPQDLFEA 237
15836097  158 RAFKKLHVDILNKKISSDDLSESLISSYLDTSGLTDPDLLIRTGGEMRVSNFLLWQIAYTELYITDTLWPDFTPQDLFEA 237
15618477  158 RAFKKLHVDILNKKISSDDLSESLISSYLDTSGLTDPDLLIRTGGEMRVSNFLLWQIAYTELYITDTLWPDFTPQDLFEA 237
166154664 161 RAFKELHQDLASKKISVNDISEELISSYLDTSGLPDPDLLIRTGGEMRVSNFLLWQIAYTELYVTDVLWPDFTANDLLEA 240
166155539 161 RAFKELHQDLASKKISVNDISEELISSYLDTSGLPDPDLLIRTGGEMRVSNFLLWQIAYTELYVTDVLWPDFTANDLLEA 240
237802878 161 RAFKELHQDLASKKISVNDISEELISSYLDTSGLPDPDLLIRTGGEMRVSNFLLWQIAYTELYVTDVLWPDFTANDLLEA 240
76789186  241 IKTYQQRSRRGGK 253
89898638  238 IKAYQHRARRGGR 250
62184817  238 IKAYQHRSRRGGK 250
29839943  238 IKAYQHRSRRGGR 250
33241919  238 INVYQQRSRRGGK 250
15836097  238 INVYQQRSRRGGK 250
15618477  238 INVYQQRSRRGGK 250
166154664 241 IKTYQQRSRRGGK 253
166155539 241 IKTYQQRSRRGGK 253
237802878 241 IKTYQQRSRRGGK 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap