Conserved Protein Domain Family
PRK14837

?
PRK14837: PRK14837 
undecaprenyl pyrophosphate synthase; Provisional
Statistics
?
PSSM-Id: 173298
View PSSM: PRK14837
Aligned: 8 rows
Threshold Bit Score: 424.622
Threshold Setting Gi: 111114942
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119952922   1 MNNNSLPMHVGIIMDGNRRWALKRGLSLFEGHKEGLKRAKEIVKYSLKLGIKYLSLYVFSTENWNRTKSEIKHLMFVIAD 80 
187917998   1 MSSNSLPMHVGIIMDGNRRWALKKGLSFFEGHKEGLKRAKEIVKHSLKLGIKYLSLYVFSTENWNRTKSEIEYLMFLIAD 80 
203287585   1 MSSNSLPSHVGIIMDGNRRWALKKGLSFFEGHKEGLKRAKEIVKHSCELGIKCLSLYVFSTENWNRTNSEIEHLMFLIAD 80 
203284045   1 MSSNSLPSHVGIIMDGNRRWALKKGLSFFEGHKEGLKRAKEIVKHSCELGIKCLSLYVFSTENWNRTNSEIEHLMFLIAD 80 
218249817   1 MNKSSLPSHVGIIMDGNRRWALGKGLSFSEGYKEGLKRAKEIVKHSLKIGIKYLSFYVFSTENWKRDDCEIEELMFLIAS 80 
15594465    1 MNKGSLPSHVGIIMDGNRRWALGKRLSSLEGYKEGLKRAKEIVKYSLRVGIKCLSFYVFSTENWRRDDCEIENLMFLIAN 80 
51598383    1 MNKRSLPSHVGIIMDGNRRWALGKGLSSLEGYEEGLKRAKEIVKHSLKVGIKYLSFYVFSTENWKRDDCEIEKLMFLITH 80 
111114942   1 MNKSSLPSHVGIIMDGNRRWALGKGLSFSEGYKEGLKRAKEIVKHSLKIGIKYLSFYVFSTENWKRDDCEIEELMFLIAS 80 
119952922  81 YLSSEFEFYSTNNIKILVSGEIEALSKEVRKSIIDAIDFTKNFDGLVLNLAINYGGRNEIVRATKKILGSGLQCETLDEI 160
187917998  81 YLSSEFEFYSANNIKILVSGDIEALSEKVRKSIIDAIEFTRNFDGLMLNLAINYGGRNEIVRATKKILGSGLQFGTLDEV 160
203287585  81 YLSSEFKFYAENNIKVVVSGDIKTLSQKVKKSIKDATNYTKNFDGLILNLAINYGGRNEIVRAIKKVLAKGLSVETLNEV 160
203284045  81 YLSSEFKFYAENNIRVVVSGDIETLSQKVKKSIEDATNYTKNFDGLILNLAINYGGRNEIVRAIKKVLAKGLSVETLNEV 160
218249817  81 YLRAEFNFYKKNGIKIIVSGDVDSLGEEVKSSIKDSVSFSKNFNNLVLNLAINYGGRNEILRAVRKFVSNNFDLESLNEN 160
15594465   81 YLRAEFDFYEKNGIKIIVSGDVESLSGEVKSSIKDSISFSKNFNNLILNLAINYGGRNEILRAVKKFVSSDFDLESLNEN 160
51598383   81 YLRAEFNFYKKNGIKIIVSGDVESLGEEVRSSIKDSVSFSKNFNNLVLNLAINYGGRNEILRAVKKFVSSNFDLESLNEN 160
111114942  81 YLRAEFNFYKKNGIKIIVSGDVDSLGEEVKSSIKDSVSFSKNFNNLVLNLAINYGGRNEILRAVRKFVSNNFDLKSLDEN 160
119952922 161 VFSKFLDNPELCDLDLLIRTGGDMRISNFLLWRIAYCEFVFSSVLWPEYSVSHYDKDLECFKNRKRNFGR 230
187917998 161 VFSKFLDNPELCDLELLIRTGGDMRISNFLLWKIAYCEFVFSSALWPEYSISHYDRDLECFKNRKRNFGR 230
203287585 161 EFAKFLDNQELGDLDLLIRTGGDMRVSNFLLWRLAYCEFIFSNVLWPDYFVFHYERDLECFKNRKRNFGR 230
203284045 161 EFAKFLDNQELGDLDLLIRTGGDMRVSNFLLWRLAYCEFIFSNVLWPDYFVFHYERDLECFKNRKRNFGR 230
218249817 161 TFSNFLDNPELPDLDLLIRTGGNIRISNFFLWRIAYSELIFSNVLWPEYYENRYSKDLECFQLRRRNFGR 230
15594465  161 IFSSFLDNPELPDLDLLIRTGGNIRISNFFLWRIAYSELIFSNVLWPEYYDTRYSKDLECFQFRRRNFGR 230
51598383  161 AFSNFLDNPELPDIDLLIRTGGNIRISNFFLWRIAYSELIFSNVLWPEYYDNRYSKDLECFQLRGRNFGR 230
111114942 161 TFSNFLDNPELPDLDLLIRTGGNIRISNFFLWRIAYSELIFSNVLWPEYYENRYSKDLECFQLRRRNFGR 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap