Conserved Protein Domain Family
PRK14827

?
PRK14827: PRK14827 
undecaprenyl pyrophosphate synthase; Provisional
Statistics
?
PSSM-Id: 173288
View PSSM: PRK14827
Aligned: 18 rows
Threshold Bit Score: 606.182
Threshold Setting Gi: 126436038
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41408239    1 MVRAERAPTSTGFPQLPPAPDDYPVFPDKSTWPVVFPELPPSPGGGPSRPPQHISKAAAPRIPADRLPNHVAIVMDGNGR 80 
15827262    1 MVRNERTLKSTDFPQLPPAPDDYPTFPDKSTWPVVFPMLPPSPDGGPRRPPQHTSKAVAPRLSAAQLPTHVAIVMDGNGR 80 
108800415   3 SSRRGAERKKSQFPQLDPPADDYPTFPDKSTWPVVFPELPPNTNGRFARPPQHTSKAAAPKIPADQVPQHVAVVMDGNGR 82 
183983651   1 MAKSARRLKSADFPQLPQAPDDYPTFPDTSSWPVVFPELPPSPDGGPRRPPQHISKTAAPRIPADRLPNHVAIVMDGNGR 80 
118618889   1 MAKSARRLKSADFPQLPQAPDDYPTFPDTSSWPVVFPELPPSPDGGPRRPPQHISKTAAPRIPADRLPNHVAIVMDGNGR 80 
118462927   1 MVRAERAPKSTGFPQLPPAPDDYPVFPDKSTWPVVFPELPPSPGGGPSRPPQHISKAAAPRIPADRLPNHVAIVMDGNGR 80 
119869544   3 SSRRGAERKKSQFPQLDPPADDYPTFPDKSTWPVVFPELPPNTNGRFARPPQHTSKAAAPKIPADQVPQHVAVVMDGNGR 82 
126436038   3 SSRRGAERKKSQFPQLDPPADDYPTFPDKSTWPVVFPELPPNTNGRFARPPQHTSKAAAPKIPADQVPQHVAVVMDGNGR 82 
224990734   1 MARDARKRTSSNFPQLPPAPDDYPTFPDTSTWPVVFPELPAAPYGGPCRPPQHTSKAAAPRIPADRLPNHVAIVMDGNGR 80 
221229740   1 MVRNERTLKSTDFPQLPPAPDDYPTFPDKSTWPVVFPMLPPSPDGGPRRPPQHTSKAVAPRLSAAQLPTHVAIVMDGNGR 80 
41408239   81 WATERGMSRTDGHKAGEAVVIDIVCGAIEIGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVVRMRRVNLNTIGVKIRWV 160
15827262   81 WANQRGLHRTEGHKMGEAVVIDVACGAIELGIKWLSLYAFSTENWKRSVEEVRFLMGFNRDVVRRRRENLKEMGVRIRWV 160
108800415  83 WATQRGLGRTEGHKMGEAVLIDITCGAIEIGIKHLTVYAFSTENWKRSTEEVRFLMGFNREVVRRRRENLNDMGVRMRWV 162
183983651  81 WATERGLRRTEGHKMGEAVVIDIACGAVELGIKWLSLYAFSTENWKRSAEEVRFLMGFNRDVVRRRRDVLNQMGVRIRWV 160
118618889  81 WATERGLRRTEGHKMGEAVVIDIACGAVELGIKWLSLYAFSTENWKRSAEEVRFLMGFNRDVVRRRRDVLNQMGVRIRWV 160
118462927  81 WATERGMSRTDGHKAGEAVVIDIVCGAIEIGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVVRMRRVNLNTIGVKIRWV 160
119869544  83 WATQRGLGRTEGHKMGEAVLIDITCGAIEIGIKHLTVYAFSTENWKRSTEEVRFLMGFNREVVRRRRENLNDMGVRMRWV 162
126436038  83 WATQRGLGRTEGHKMGEAVLIDITCGAIEIGIKHLTVYAFSTENWKRSTEEVRFLMGFNREVVRRRRENLNDMGVRMRWV 162
224990734  81 WATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWV 160
221229740  81 WANQRGLHRTEGHKMGEAVVIDVACGAIELGIKWLSLYAFSTENWKRSVEEVRFLMGFNRDVVRRRRENLKEMGVRIRWV 160
41408239  161 GSRPRLWRSVINELAIAEEMTKRNDVITVNYCVNYGGRAEIAEATKEIARLAAAGRLNPERITESTVAHHLQRPDIPDVD 240
15827262  161 GSRPRLWRSVINELAIAEHMTAGNDVITINYCVNYGGRTEIAEATREIARLAAAGRLNPERITESTITRHLQRPDIPDVD 240
108800415 163 GSRPRMWRSVSKEFDIAEEMTVDNDVITINYCVNYGGRTEIVEAARQLAQEAVDGKVNPSRITEAAFARHLHRPDIPDVD 242
183983651 161 GSRPRLWRSVINELAVAEAMTNNNDVITINYCVNYGGRTEIAEATRDIAREVAAGRLNPERITESTIARHMQRPDIPDVD 240
118618889 161 GSRPRLWRSVINELAVAEAMTNNNDVITINYCVNYGGRTEIAEATRDIAREVAAGRLNPERITESTIARHMQRPDIPDVD 240
118462927 161 GSRPRLWRSVINELAIAEEMTKRNDVITVNYCVNYGGRAEIAEATKEIARLAAAGRLNPERITESTVAHHLQRPDIPDVD 240
119869544 163 GSRPRMWRSVSKEFDIAEEMTVDNDVITINYCVNYGGRTEIVEAARQLAQEAVDGKVNPSRITEAAFARHLHRPDIPDVD 242
126436038 163 GSRPRMWRSVSKEFDIAEEMTVDNDVITINYCVNYGGRTEIVEAARQLAQEAVDGKVNPSRIAEAAFARHLHRPDIPDVD 242
224990734 161 GSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVD 240
221229740 161 GSRPRLWRSVINELAIAEHMTAGNDVITINYCVNYGGRTEIAEATREIARLAAAGRLNPERITESTITRHLQRPDIPDVD 240
41408239  241 LFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACQEYASRNRRFGSA 296
15827262  241 LFVRTSGEQRSSNFMLWQAAYTEYIFQDKLWPDYDRRDLWAACEEYASRNRRFGSA 296
108800415 243 LFIRTSGEQRASNFLLWQSAYAEYVFQDKLWPDYDRRDLWAACEEYVSRNRRFGRA 298
183983651 241 LFLRTSGEQRSSNFMLWQSAYAEYIFQDKLWPDYDRRDLWAACEEYASRNRRFGSA 296
118618889 241 LFLRTSGEQRSSNFMLWQSAYAEYIFQDKLWPDYDRRDLWAACEEYASRNRRFGSA 296
118462927 241 LFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACQEYASRNRRFGSA 296
119869544 243 LFIRTSGEQRASNFLLWQSAYAEYVFQDKLWPDYDRRDLWAACEEYVSRNRRFGRA 298
126436038 243 LFIRTSGEQRASNFLLWQSAYAEYVFQDKLWPDYDRRDLWAACEEYVSRNRRFGRA 298
224990734 241 LFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA 296
221229740 241 LFVRTSGEQRSSNFMLWQAAYTEYIFQDKLWPDYDRRDLWAACEEYASRNRRFGSA 296
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap