Conserved Protein Domain Family
PRK14826

?
PRK14826: PRK14826 
putative deoxyribonucleotide triphosphate pyrophosphatase; Provisional
Statistics
?
PSSM-Id: 173287
View PSSM: PRK14826
Aligned: 11 rows
Threshold Bit Score: 389.026
Threshold Setting Gi: 193215546
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
193215546   4 YPEIPAGKTALILATGNRDKVAEIKPLLMPIAEHLVIFSLADLPKLPEVEENAPTLEGNAKKKAKEIFEHTQSHFANLIT 83 
119356501   1 MPQSADNRIIVILATANRDKVKELRPLLEHISPLFTVHALHELGVEVEIEETEDSLEGNALLKARAIFSLLSDRFPFMIA 80 
145219308   1 MTPISRTPLTIILATANPDKVRELRPLLEGIDPCFSVISLAEAGIAVDIEETETTLEGNAMLKANAIFNLLNGRFPAMIA 80 
189347225   4 NSICTEKTIPVILATGNPDKVKELRPMLEHISPLFSVFSLSDLDIAADIEETEQTLSGNALLKADGIFAILEQRFPFLVT 83 
189500796   1 -MQNATETLTIVLATNNRDKVREIKPLLEHIAPHISVNSLADLNVELEIEETEETLEGNAKLKTDAVFNHLSDRFAFLIT 79 
194337267   1 MPATADKEITIVLATANRDKVKELRPLLETISPLFTVRTLHELGVDVEIEETEETLEGNALLKARAIFAILSERFPFMIA 80 
194334496   1 MTASRAEKTAIVLATNNPDKVREIKPMLMGLSSSVQVYSLSDLGVDRAIEETESTLEGNAKLKADAIFNHLSDRFENLIS 80 
193213344   1 ---MSTETIDIVLATGNRDKVRELKPVLEGIHPALRVRALFELGLEADVEETETTLEDNARLKADAIFELVRSQLNHFIA 77 
78186333    1 -MQTPPDITTIVLATGNRDKVRELRPLLESISARFRVTTLMDEGIEVDIEETEQTLEGNAILKARAIFEMLSAKFPSMIA 79 
78188461    1 ----MTDTITIILATGNRDKVKELRPLLEHISPIITVVTLPELGVSVDVEETEETLEGNALLKARAIFSILENRFPFLIA 76 
21673169    1 -MEPKHPEITIVLATGNKDKVRELKPVLEALASGIHVRSLHDLGLDIDVEETEPTLEGNARLKADAIFELVAPRLDWFIA 79 
193215546  84 LADDTGLEVAALNGAPGVYSARYAATPQKEKPSYADNVDKLLSDMQNLTNRTARFRTVIALVSRTNfGKESsPIYFEEVL 163
119356501  81 LADDTGLEVEALHGAPGVYSARFAPMPDGRTPTYQDNVSHLLYCMNGIADRSARFRTVVALKGSLP-SAQG-SFLFERTA 158
145219308  81 FADDTGLEVNALGGAPGVYSARYAPVANGEKPTYRDNVTHLLNEMEGEKDRSARFRTVIALKGIVE-GKNG-TTGIEETI 158
189347225  84 IADDTGLEVLSLGGEPGVLSARFAPVKTGMKPTYEDNIDHLLLRMNGIKERNARFRTVIALKGRIP-SGET-AYAFRLTA 161
189500796  80 VADDTGLEVSGLNGAPGVYSARFAPVPEGTSPTYDDNVNHLLKEMENVTDRKATFRTVVALKGRIT-GKNA-PRFFETAV 157
194337267  81 LADDTGLEVDGLDGAPGVYSARFAPVPDGQSPTYKDNVAHLLHCMKGIANREARFRTVIALKGALP-SAEG-CFRFEHTA 158
194334496  81 LADDTGLEVDALKGAPGVYSARFAPMPEGREPSYEDNVQHLLTTMQHTLERSATFRTVIAIKGRLS-EKNG-ISEIEETV 158
193213344  78 LADDTGLEVDALNGEPGVYSARFAPMPPGQSPTYADNVRHLLDRMTGKTDRSARFRTVIAMKGLLP-SAADnDVTIEETV 156
78186333   80 FADDTGLEVDQLGGRPGVYSARFAPRPEGEKPSYSDNVRHLLQEMEGKVERSARFRTVIALKGTIP-GHDD-GRVFEHIE 157
78188461   77 LADDTGLEVAALDGAPGVYSARYAPTADGTAPTYSDNVNHLLKNMAGKEERSACFRSLIALKGRIP-TGDSkAFAFEQTA 155
21673169   80 LADDTGLEVDALGGAPGVYSARYAPVPEGVARTYEDNVRHLLSEMRGKSKRTARFRTVIAMKGRLP-AANGsAVEIEETT 158
193215546 164 EATVQGEITYEKHGSSGFGYDPIFRVSEVGKTFAELSVSEKNQISHRGKAVQTAVKFLTKCFLG 227
119356501 159 EGLVEGSITLNQQGDEGFGYDPIFLVHATGKTYAEMSTDEKNTLSHRSLAVQKAITELRNIFEQ 222
145219308 159 EGLVEGTLTTEADGSGGFGYDPIFMVTAAGKTYGRMSGTEKNSLSHRALATKKAIAFLHTIL-- 220
189347225 162 EGVVEGSIVEERKGIMGFGYDPVFHVTSAGKTYAEMAAEEKNTISHRAIALQKASNALSDIMKK 225
189500796 158 EGAVEGEITREKTGDKGFGYDPVFWVNSAQATFAQMSTEEKNRLSHRSKAVKKAVEKLREILNP 221
194337267 159 EGVVPGSITLEEQGVEGFGYDPLFLVHNTGKTYAEMSTTEKNRLSHRALAVQHAVNYLKNILQQ 222
194334496 159 EGKVAGSIAKEKTGNGGFGYDPIFWVNSAQATFAEMTTEEKNRLSHRSLAVQKAVETLRDILS- 221
193213344 157 EGSVEGVITETTIGEGGFGYDPIFMPAGTGKTFAQLTIDEKNAISHRGRAVQAAVRRIRQLLEQ 220
78186333  158 EGVAEGSITTAPEGKGGFGYDPVFRSEATKKTFARMTPEEKNTISHRALAVKRTISWLHTITNT 221
78188461  156 AGEVHGSITREPFGDGGFGYDPVFYVEATAKTYAQMSIAEKNSMSHRARAVQQAIADLRTLFAE 219
21673169  159 DGHIDGLITTEPKGNGGFGYDPVFAPEGMDRTFAQLGIDEKNAISHRGRAVVAAAKRIGEYLSQ 222
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap