Conserved Protein Domain Family
PRK14825

?
PRK14825: PRK14825 
putative deoxyribonucleotide triphosphate pyrophosphatase; Provisional
Statistics
?
PSSM-Id: 173286
View PSSM: PRK14825
Aligned: 8 rows
Threshold Bit Score: 306.477
Threshold Setting Gi: 15594592
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15594592    1 MKTLFFATTNENKINEVKNILDIPNLNLIVPQNFNIKETGKTFKENSLLKAKALFEILNNNQNVFGEDSGLCIEALNLEP 80 
51598507    1 MKTLFFATTNENKINEVKNILDMPNLNLVVPKNFNIKETGTTFKENSLLKAKALFAILNKNQNVFGEDSGLCIEALNLEP 80 
111115072   1 MKTLFFATTNENKINEVKNILDIPNLNLIVPQNFNIKETGKTFKENSLLKAKALFEILNKNQNVFGEDSGLCIEALNLEP 80 
187918120   1 MKTLFFATTNINKINEVKQILDIPNIKIEIPKNFDVKETGKTFKENSLIKAKALFESLGRKHPVFSEDSGLCIEALNLEP 80 
218249462   1 MKTLFFATTNENKINEVKNILDIPNLNLIVPQNFNIKETGKTFKENSLLKAKALFEILNNNQNVFGEDSGLCIEALNLEP 80 
203287703   1 MKTLFFATSNINKINEVKQILDIPKIKIEIPQNFDIKETGKTFKENSLLKAKALFKILNNKQPVFSEDSGLCIEALNMEP 80 
203284167   1 MKTLFFATSNINKINEVKQILDIPKIKIEIPQNFDIKETGKTFKENSLLKAKALFKILNNKQPVFSEDSGLCIEALNMEP 80 
119953045   1 MKTLFFATTNINKINEVKQILDIPNIKIKIPKNFDVKETGKTFKENSLLKAKTLFESLDKKKPVFSEDSGLCIKALNLEP 80 
15594592   81 GIYSKRYDTYKLCKKLSTNEKNQLILDLMKNEKNRKAYFICNISYISKNGQILNFEGIIKGKIALSLNDKKNYGFGYDSI 160
51598507   81 GIYSKRYDTYKLCKKLSTNEKNQLILDLMKNEKNRKAYFICNISYISKDRQILNFEGIIKGEIALSLNDDKNYGFGYDSI 160
111115072  81 GIYSKRYDTYKLCKKLSTNEKNQLILDLMKNEKNRHAYFICNISYISKNRQISNFEGIIKGKIALSLNDDKNHGFGYDSI 160
187918120  81 GIYSKRYDQYKLGKKLGTKEKNHFIIDLMKDKENRAAYFICIVSHIAKDGTITNFEGIFNGTIALDIDCCKKNGFGYDPI 160
218249462  81 GIYSKRYDTYKLCKKLSTNEKNQLILDLMKNEKNRKAYFICNISYISKNGQILNFEGIIKGKIALSLNDKKNYGFGYDSI 160
203287703  81 GIYSKRYDQYKLGKKLDNNEKNHLIIDLMREQNNRTAYFICVISYIDVDGTINNFEGMLKGTIALNIDYYQKNGFGYNPI 160
203284167  81 GIYSKRYDQYKLGKKLDNNEKNHLIIDLMREKNNRTAYFICVISYIDVDGTINNFEGMLKGTIALNIDYYQKNGFGYDPI 160
119953045  81 GIYSKRYDQYKLGKKLGTNEKNHLIIDLMKDKENRTAYFICIVSHISIDGTITNFEGILNGTIALDIDCYKKNGFGYDPI 160
15594592  161 FLTKNNKKLSDLTLEEKNKISHRGIAFLKFKKFLLKSLF 199
51598507  161 FLTKNNKKLSDLTLEEKNKISHRGIAFSKFKKFLLKSLF 199
111115072 161 FLTKNNKKLSDLTLEEKNKISHRGIAFSKFKKFLLESLF 199
187918120 161 FLTTNNKRLSELNLEEKNKISHRGIAFTKFKKFLMQSLD 199
218249462 161 FLTKNNKKLSDLTLEEKNKISHRGIAFLKFKKFLLKSLF 199
203287703 161 FLTTNNKRLSELNLEEKNKISHRGIAFDKFKKFLMQFLD 199
203284167 161 FLTTNNKRLSELNLEEKNKISHRGIAFDKFKKFLMQFLD 199
119953045 161 FLTANNKRLSELTLTEKNKISHRGIAFAKFKKFLMQSLN 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap