Conserved Protein Domain Family
PRK14818

?
PRK14818: PRK14818 
NADH dehydrogenase subunit B; Provisional
Statistics
?
PSSM-Id: 173279
View PSSM: PRK14818
Aligned: 5 rows
Threshold Bit Score: 333.072
Threshold Setting Gi: 162457344
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
197121687   1 MAARMDPGIGGDVTLLHTSQLDNLINLARASSLYYLTFGLACCGIELMQTGGPRADVMRFGAIPRASPRQADFMIVAGTL 80 
220916483   1 MAARMDPGIGGDVTLLHTSQLDNLINLARASSLYYLTFGLACCGIELMQTGGPRADVMRFGAIPRASPRQADFMIVAGTL 80 
162457344  14 WEAKYESDGGGVITTSVDQTVNWLLNWGRSNSVWYMLFGLACCAIELMQTGGPRGDLERFGAAPRPSPRSSDLFIIAGTL 93 
153004155   1 MTARTMDAGTGDVTLFHTSQLDKLINMARENSLWYLLFGLACCGIELMQFGGPRADVMRFGAIPRASPRQADFMIVAGTL 80 
86158994    1 MAARMDPGIGGEVTLLHTSQLDNLINLARASSLYYLTFGLACCGIELMQTGGPRADLMRFGAIPRASPRQADFMIVAGTL 80 
197121687  81 TYKMAERARLLYDQMPEPKYVISMGSCSNCGGLFQLGYSVCKGVDKVIPVDVYVPGCPPRPEALTEGLLRLQEIVRSEPW 160
220916483  81 TYKMAERARLLYDQMPEPKYVISMGSCSNCGGLFQLGYSVCKGVDKVIPVDVYVPGCPPRPEALTEGLLRLQEIVRSEPW 160
162457344  94 TYKMATRVKRLYDQMSEPRFVISMGSCSNCGGLFQYAYSVCKGVDQIIPVDVYVPGCPPRPEALLEGLLKIQEKIKSERA 173
153004155  81 TYKMAERAKLLYDQMPEPKYVISMGSCSNCGGLFQLGYSVCKGVDKVIPVDVYVPGCPPRPEALTEGLIRLQELIRSEPW 160
86158994   81 TYKMAERARLLYDQMPEPKYVISMGSCSNCGGLFQLGYSVCKGVDKVIPVDVYVPGCPPRPEALTEGLLRLQEIVRSEPW 160
197121687 161 STKRRPAAQAEGA 173
220916483 161 STKRRPAAQAEGA 173
162457344 174 LGRR----GATGG 182
153004155 161 ATKRRPAKGSAA- 172
86158994  161 STKRRPAAQAEGA 173
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap