Conserved Protein Domain Family
PRK14817

?
PRK14817: PRK14817 
NADH-quinone oxidoreductase subunit B
Statistics
?
PSSM-Id: 173278
View PSSM: PRK14817
Aligned: 5 rows
Threshold Bit Score: 382.77
Threshold Setting Gi: 108758077
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108758077   1 MADADLANIVTTRRDESMGWLQSIVSKGLGWARKYSLFTYPYATACCGMEYMSVAASRHDISRFGAEFPRFSPRQADLLM 80 
86158991    2 ASELDGLPVIATRREEAEGFLQGLVSKSLGWARKYSLFTYPFVTACCGMEYMTMASARYDSDRFGAAMPRFSPRQADLLM 81 
153004158   2 ASELDNLPVITTRREEAQGFLQGLVSKGLGWARKYSLFQYPFVTACCGMEFMTVASARYDLDRFGAALPRFSPRQADLLI 81 
220916486   2 ASELDGLPVIATRREEAEGFLQGLVSKSLGWARKYSLFTYPFVTACCGMEYMTMASARYDSDRFGAAMPRFSPRQADLLM 81 
197121690   2 ASELDGLPVIATRREEAEGFLQGLVSKSLGWARKYSLFTYPFVTACCGMEYMTMASARYDSDRFGAAMPRFSPRQADLLM 81 
108758077  81 VVGTINLKQAPILKRVYEQMAEPKWVVAFGVCASSGGFYDNYAVLQGIDRIIPVDVYIPGCPPRPEQVLDGLMLLQDKIG 160
86158991   82 VVGTVNCKQAPILQRIYEQMADPKWVMAFGVCASSGGFYDNYATVQGIDRIIPVDVYVPGCPPRPEQVLDGIMLLQKKIQ 161
153004158  82 VVGTVNCKQAPILRRVYEQIAEPKWVVAFGVCASSGGFYDNYATVQGIDRIVPVDVYIPGCPPRPEQVLDGIMLLQQKIQ 161
220916486  82 VVGTVNCKQAPILQRVYEQMADPKWVMAFGVCASSGGFYDNYATVQGIDRVIPVDVYVPGCPPRPEQVLDGIMLLQKKIQ 161
197121690  82 VVGTVNCKQAPILQRVYEQMADPKWVMAFGVCASSGGFYDNYATVQGIDRVIPVDVYVPGCPPRPEQVLDGIMLLQKKIQ 161
108758077 161 NQVHRIAEREEANPTAArhnlllSMNK 187
86158991  162 NQSHKLIDRKPLPVIAG------GPGR 182
153004158 162 GQQHKLIDRKPLPVVGQe-----PISR 183
220916486 162 NQSHKLIDRTPLPVISG------GAGR 182
197121690 162 NQSHKLIDRKPLPVISG------GAGR 182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap