Conserved Protein Domain Family
PRK14816

?
PRK14816: PRK14816 
NADH-quinone oxidoreductase subunit B
Statistics
?
PSSM-Id: 173277
View PSSM: PRK14816
Aligned: 5 rows
Threshold Bit Score: 374.248
Threshold Setting Gi: 212550775
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
212550775   1 MKTEDFRDNEYLEEYLKELWGNGANIAIAKLNDLINWGRSNSVWPLTFATSCCGIEFMCLGAARYDFARFGWEVTRNSPR 80 
150004312  11 IPYEDFKDNEYLENMVKQLNEGGTKVLVGCLDDLINWGRSNSLWPLTFATSCCGIEFMAVGAARYDFARFGFEVARASPR 90 
29349474   12 IPYDEFIDNESLEKLVKELNTGGANVFLGVLDDLVNWGRSNSLWPLTFATSCCGIEFMALGAARYDMARFGFEVARASPR 91 
53712161   12 IPYEDFIDNESLEKMVKELNEGGANVFVGVLDDLINWGRSNSLWPLTFATSCCGIEFMALGAARYDMARFGFEVARASPR 91 
60680345   12 IPYEDFIDNESLEKMVKELNEGGANVFVGVLDDLINWGRSNSLWPLTFATSCCGIEFMALGAARYDMARFGFEVARASPR 91 
212550775  81 QADVVFCCGTIVHKMAPVLKRLYDQMSEPKYVIALGSCAISGGPFKSSYHTIMGIDKIIPVDVYIPGCPPRPDAMIYGMI 160
150004312  91 QADMIMVAGTITHKMAPVLKRLYDQMADPKYVIAVGGCAISGGPFKKSYHVLNGVDKILPVDVYIPGCPPRPEALLYGMI 170
29349474   92 QADMIMVCGTITNKMAPVLKRLYDQMPDPKYVVAVGGCAVSGGPFKKSYHVLNGVDKILPVDVYIPGCPPRPEAFYYGMM 171
53712161   92 QADMIMVCGTITNKMAPVLKRLYDQMADPKYVIAVGGCAVSGGPFRKSYHVVNGVDKILPVDVYIPGCPPRPEAFYYGMM 171
60680345   92 QADMIMVCGTITNKMAPVLKRLYDQMADPKYVIAVGGCAVSGGPFRKSYHVVNGVDKILPVDVYIPGCPPRPEAFYYGMM 171
212550775 161 QLARKIKVQNFFklpnlshieGNSLKKGERQ 191
150004312 171 QLQRKVKLEKFF---------GGVNRKENEP 192
29349474  172 QLQRKVKIEKFF---------GGTNRKEKKP 193
53712161  172 QLQRKVKIEKFF---------GGVNRKEKKP 193
60680345  172 QLQRKVKIEKFF---------GGVNRKEKKP 193
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap